Abstract
Enteroendocrine cells (EEs) in metazoan are diversified into multiple subtypes that occupy specific regions along the digestive tract to fulfill their functions. How to establish this regional pattern of EE subtypes is unclear. Here, we investigated the complex distribution patterns of three major EE subtypes along the length of the pupal and adult Drosophila midgut, and found that regional EE patterning is regulated by WNT and BMP signaling in a spatiotemporally dependent manner. Furthermore, there are both Notch-dependent and -independent cell division modes of EE progenitors that contribute to the generation of regional EE diversity. Our findings suggest that intercalated WNT and BMP morphogen gradients emanating from compartment boundaries play a critical role, not only in establishing regional ISC identity and the resulting EE diversity during development, but also in maintaining regional EE diversity in adulthood—a paradigm that may be conserved in mammals.
Introduction
As an important organ for food digestion and nutrient absorption, the intestine is compartmentalized to assign labor along the length of digestive tract for efficient digestion, absorption and metabolic regulation. The spatiotemporal regulation of intrinsic transcription factors (TFs) and extrinsic signaling pathways is involved in the development and specification of intestinal epithelial cells to confer their regional specific identity and function, and abnormal regulation of these factors and pathways may result in intestinal dysfunction and metaplasia 1–5.
Enteroendocrine cells (EEs), which originate from local intestinal stem cells (ISCs), exhibit multiple subtypes that are typically located in specific regions of the digestive tract, where they are responsible for sensing stimuli from the gut lumen and secreting peptide hormones and neurotransmitters, facilitating communication with local cells as well as distant organs to regulate various physiological processes 6,7. Recent single-cell RNA sequencing (ScRNA-seq) studies have provided a high-resolution understanding of EE heterogeneity in both mammals and Drosophila 8–12. Additionally, the spatial location of each EE subtype often reflects their regional adaptability to specific biological functions 6. For instance, L cells, mainly distributed in the lower small intestine and large intestine, exert negative feedback regulation by secreting glucagon-like peptide-1 (GLP-1), which suppresses appetite and promotes insulin secretion, thereby maintaining plasma glucose homeostasis 13,14. GLP-1 agonists have been developed for clinical use to treat diabetes and obesity 15,16. Hence, understanding regional EE diversity will not only enhance our knowledge of gut compartmentation and function, but may also provide insight into metabolic diseases and other EE-dysfunction related diseases.
Due to the conservation of gut epithelial lineages and regulatory signaling pathways 1,6,17,18, combined with its small size and powerful genetic tools, Drosophila offers a compelling genetic model for investigating regional regulation in the digestive tract. The Drosophila intestine is divided into the foregut, midgut and hindgut based on its developmental origin. The endodermal-derived midgut encompasses five major anatomical regions (R1-R5) (Figure S1A) and can be further subdivided into 13 subregions with different metabolic and digestive functions 19,20. Similar to mammals, Drosophila EEs are also derived from ISCs 21,22. A transient activation of the transcription factor Scute induces ISC to generate a transient EE progenitor (EEP), which undergoes one round of asymmetric cell division before terminal differentiation, yielding a pair of EEs 23,24. Recent single-cell analyses of EEs in adult Drosophila midgut have led to the identification of totally 10 EE subtypes, which can be generally categorized into three major classes 12,25. These EE subtypes are dispersed throughout the adult Drosophila midgut and also exhibit specific regional distribution and functional adaptation 26–30. For instances, Neuropeptide F (NPF)-secreting EEs residing in the anterior and middle midgut can sense sugar intake to regulate glucose and lipid metabolism 31; Allatostatin C (AstC)-expressing EEs enriched at the posterior midgut can be activated by starvation to promote food intake and energy mobilization 32; and Diuretic hormone 31 (DH31)-expressing EEs are located nearby Malpighian tubule and have been implicated in regulating water flux homeostasis 18. The mechanisms driving these distribution patterns remain unclear.
One potential mechanism underlying regional EE diversity is the regional identity of ISCs. ISCs located in specific regions of the gut possess distinct regional identities and therefore give rise to region-specific progeny. A well-studied example is the development of the copper cell region (CCR) in the middle midgut, where BMP signaling is activated to induce lab expression. Consequently, it promotes the adoption of a gastric stem cell identity, enabling these ISCs to generate acid-secreting copper cells rather than enterocytes 33,34. However, ISCs in the anterior and posterior midgut exhibit largely similar transcriptomic profiles and cluster together in single-cell principal component analysis (PCA) 25. Furthermore, no specific gene markers have yet been identified that distinguish ISCs in the anterior midgut from those in the posterior region. These findings suggest that additional mechanisms may contribute to the regulation of regional EE diversity.
In this work, we characterized the regional distribution of EE subtypes (at the class level) and asymmetric cell division patterns of EEPs along the length of pupal and adult Drosophila midgut, and investigated the function of the extrinsic niche signals, including Notch, WNT and BMP pathways, in the regulation of regional EE diversity. Our results suggest the participation of both intrinsic (regional ISC identity) and extrinsic (morphogen gradient) mechanisms in shaping regional EE diversity.
Results
Complex distribution patterns of class I, II and III EEs along the length of the Drosophila midgut
In addition to AstC+ class I and Tachykinin+ (Tk) class II EEs, our recent scRNA-seq analysis of the EEs has revealed the existence of another EE subtype named as class III EEs, which express neither AstC nor Tk, but do express peptide hormone CCHamide-2 (CCHa2) 12 (Figure S1A). We confirmed this pattern in the R2 region using a Gal4 knock-in line of CCHa2 (Figure S1B). Interestingly, CCHa2 was also found to be expressed in a subset of AstC+ class I EEs in the R4 region (Figure S1C-E). Therefore, class III EEs are localized to the R2 region with a specific expression pattern of peptide hormones: CCHa2+, AstC−, Tk−.
Combining the region-specific GAL4 enhancer trap lines 19 with the immunostaining of CCHa2 antibodies, we found that CCHa2+ class III EEs began to appear in the R1b region and disappeared at the junction between R2 and R3 regions (Figure S1F and S1H). CCHa2 expression reappeared in the R4b and R4c regions and disappeared in the R5 region (Figure S1G-H). Consistent with previous studies 12, Tk+ class II EEs are distributed along the whole gut except for the R4b region, where EEs are all belong to AstC+ class I (Figure S1G-H).
Based on this information, we next co-stained AstC, Tk and Pros (Prospero, a pan-EE marker) in the midgut of CCHa2-LexA, LexAOP-GFP (abbreviated as CCHa2-LexA>GFP) flies to determine the distribution pattern of class I, II and III EEs along the length of midgut at subregion resolution (Figure 1). The AstC+ class I and Tk+ class II EEs were found in the R3-R4a and R4c-R5 regions with the ratio of approximately 1:1 (Figure 1D, 1F and 1G), a pattern that is consistent with the traditional view that each EEP divides asymmetrically prior to differentiation, yielding one class I EE and one class II EE 23,35. The rest of regions or subregions, however, do not exactly follow this pattern.

The distribution pattern of EE subtypes along the length of adult Drosophila midgut.
(A-F) Midguts of CCHa2-LexA>GFP flies stained with anti-Pros (blue), anti-AstC (white) and anti-Tk (red) antibodies 10 days after eclosion. Separated color channels for the insets from different gut regions in (A) were enlarged and displayed in (B-F), showing EE distribution characteristic of different gut regions. Scale bar represents 300 μm. (G) Quantification of the three major EE subtype percentage in different gut regions of flies 10 days after eclosion. Error bars represent Mean ± SEM, n=5. (H) Quantification of EE subtype percentage in the R4bc region of flies 10 days after eclosion. Error bars represent Mean ± SEM, n=5. (I) A schematic diagram showing the distribution patterns of the three EE subtypes along the Drosophila midgut.
In the R1a region, the resident EEs are almost all Tk+ class II EEs (Figure 1B and 1G); The R1b-R2 region is rather complex as all three classes of EE subtypes are found in this area: The class II EEs accounts for about half of the total EE number in this region, followed by class III EEs, accounting for about 30-40%, and the rest are class I EEs (Figure 1C and 1G). Moreover, the proportions of three EE subtypes in R1-R2 change in a gradient manner, with more class III EEs towards anterior, and more class I and II EEs towards posterior (Figure 1G).
The R4b region is even more surprising, as virtually all EEs in this region are AstC+ class I EEs (Figure 1E and 1G). In addition, a subset (about three-quarters) of these EEs is CCHa2+ (Figure 1H). The annotated distribution pattern of class I, II and III along the length of midgut is shown in Figure 1I. The distinct regional EE patterns, especially found in R1a, R1b-R2 and R4b provide an opportunity for the genetic dissection of the mechanisms underlying regional EE diversity.
The EE distribution pattern is established at late pupal stage
During the pupation of Drosophila, the midgut epithelium undergoes dramatic changes to produce definitive adult midgut 36,37. Specified prior to pupal formation, EEs are lost at early pupal stage, but re-emerge later from pupal ISCs 36,38. Therefore, we wondered whether the regional diversity of EE subtypes was established at this stage.
Similar to the adult midgut, we found that the regional boundary markers GMR46B08-Gal4 and GMR50A12-Gal4 have already expressed in the midguts at late pupal stage—96h after pupa formation (APF) (Figure S1I-J). Although the expression domain was wider than that in adult midguts (Figure S1G-H), the trends of regional-specific expression had already been determined. Immunostaining of pupal midguts with Tk, AstC and CCHa2 showed that the distribution pattern and proportion of class I, II and III EE subtypes in different regions were virtually the same as those in adults (Figure S2). We propose that Drosophila midgut compartmentation and regional EE subtype diversity were established at the pupal stage and maintained to the adulthood. After pupal formation, the pupal ISCs undergo two rounds of cell divisions to generate EE mother cells or EEPs, which then divide once to yield a pair of EEs 24,36,38. Therefore, EEs found in late pupal midgut are all generated by pupal ISCs, implying that regional EE diversity may be determined or contributed by the regional identity of ISCs.
It is worth mentioning that in the R5 region of the late pupal midgut, approximately half of the Pros+ EEs were Tk+ class II, but the other half were negative for AstC expression, so as for CCHa2 (Figure S2F and S2H). Considering the expression pattern in the newly enclosed and adult flies, in which these cells are positive for AstC (Figure 1F-G and S2G), these R5 EEs at the pupal stage are likely immature EEs, which are expected to reach maturity shortly after eclosion.
Both symmetric and asymmetric division of EEPs contribute to regional EE diversity
In the adult midgut, EEPs undergo a single asymmetric division to produce a pair of EEs, typically consisting of one class I EE and one class II EE 23,35. Given the observations that several gut regions, including R1, R2 and R4b, do not harbor this typical 1:1 EE pattern, we asked how different subtypes of EEs are specified from EEPs. Because ISCs are normally quiescent and EEPs are rarely found in the intestinal epithelium, we induced intestinal damage by feeding flies with 5% Dextran Sulfate Sodium (DSS) solution 39, which can rapidly induce ISC proliferation and differentiation to replenish damaged enterocytes and EEs. Then the newly generated EE pairs can be distinguished by two EEs that are in close proximity with each other 23,35 (Figure 2A-E). As expected, the majority of the EE pairs found in the R3-R4a and R4c-R5 regions consisted of one class I and one class II EE (Figure 2C and 2E-F), which fits into the canonical view that each EEP divides asymmetrically to yield class II/I EE pair.

Choices of symmetric or asymmetric division of EEPs contribute to regional EE diversity.
(A-E) Midguts stained with anti-Pros (blue) and anti-AstC (white) antibodies in CCHa2-LexA>GFP, Tk-Gal4>RFP flies fed with 5% DSS for 2-3 days. EE pairs were pointed by arrow head pairs. Scale bar represents 25 μm. (F) Quantification of different EE subtype pair percentage in different gut regions. (R1a: n=14; R1b-R2a: n=7; R2b: n=25; R2c: n=25; R3-R4c: n=48; R4b: n=64; R4c-R5: n=71) (G) Quantification of different EE subtype pair percentage in the R4b region. (n=64) (H) Speculation of EE subtype percentage in different gut regions by taking the percentage of EE subtype pairs from (F) to generate EEs. (I) Speculation of EE subtype percentage in the R4b region by taking the percentage of EE subtype pairs from (G) to generate EEs.
However, the two EEs in the EE pairs found in the R1a region were all Tk+ (Figure 2A and 2F), and in the R4b region were all AstC+ (Figure 2D and 2F), suggesting that EEPs in these two regions undergo symmetric cell division to yield identical or “symmetric” EE pairs.
We next examined the EE pairs in R1b-R2 regions, where class I, II and III EE subtypes co-reside. We found that the majority of EE pairs were asymmetric pairs, as about 60% EE pairs consist of Tk+ class II + CCHa2+ class III EE, and 35% consist of Tk+ class II + AstC+ class I EE (Figure 2B and 2F). The remaining symmetric pairs or asymmetric class I/III pairs were rarely found. The percentage of these asymmetric pairs were largely consistent with the percentage of class I, II and III EE subtypes found in these regions (Figure 2H and 1G), suggesting that EEs in R1b-R2 regions are generated through these two modes of EEP asymmetric cell divisions, one that generates class II/III EE pair, and the other that generates class II/I EE pair.
It worth mentioning that, although the EE pairs found in R4b region were considered symmetric AstC+/AstC+ class I EE pair (Figure 2D and 2F), we found that about 70% of these EE pairs were not strictly identical, with one expressing CCHa2 while the other not (Figure 2D and 2G), and the consequence of these cell division modes were largely consistent with the percentage of EE subtypes found in this region (Figure 2I and 1H). How this heterogeneity occurs is unclear but as described shortly, the loss of Notch does not affect this CCHa2 pattern in the AstC+ EE pairs, suggesting this heterogeneity is not generated by Notch-mediated lateral inhibition.
It is known that tissue damage caused by DSS treatment can induce the activation of multiple signaling pathways from the ISC environment, which could potentially affect the regular generation of regional EE diversity. We therefore also used a different approach to induce EE pair formation. Overexpression of scute in ISCs could induce rapid ISC proliferation and differentiation toward EE lineage and form EE clusters 23,40. We therefore conditionally induced scute overexpression in ISCs for 12-48 hours, which led to a large number of EE pairs (Figure S3A-E). We then performed a similar analysis and quantified the proportion of symmetric or asymmetric EE pairs in each gut regions, the results were largely consistent with that obtained under DSS treatment conditions (Figure S3F-I). Therefore, symmetric and asymmetric division of EEPs varies across different regions of the gut, thereby contributing to regional EE subtype diversity.
Notch is required for the specification of class II but not for class I and III EEs
It is known that Notch is required for the asymmetric division of EEPs to generate asymmetric class I/II EE pairs, as the loss of Notch signaling leads to the loss of class II EE lineage 35,41. But it is unclear if Notch is required for the specification of class III EEs, and for the generation of II/III and class I/III asymmetric EE pairs found in R2 region.
We used MARCM system 42 to generate Notch knockdown or Dl mutant clones. Compared to WT clones (Figure S4A and S4C), all Notch RNAi or DeltaRevf10 (abbreviated as DlRevf10) homozygous clones in the R2 region consist of clustered small diploid cells that include CCHa2+ class III and AstC+ class I EEs, while class II EEs were only observed outside of the mutant clones (Figure S4B and S4D). These results suggest that local Delta-Notch signaling is essential for the establishment of class II but not class I or III EEs.
To further validate the role of Delta-Notch signaling in EE subtype differentiation along the whole midgut, we introduced Notch RNAi in ISCs for 5-10 days in adult midguts, which led to the generation of many EE clusters (or EE tumors derived from Notch-depleted ISCs) along the length of the midgut (Figure 3). We then examined the EE subtype identity in these EE clusters in R1-R5 regions respectively. Interestingly, no EE clusters were found in R1a (Figure 3A), indicating that ISCs in this region are relatively quiescent. As expected, in R3-R4a and R4c-R5, where normally only class I/II EEs reside, all EEs in the EE clusters became AstC+ class I EEs (Figure 3C and 3E).

Notch is dispensable for the specification of both class I and III EE subtypes.
(A-E) Midguts stained with anti-Pros (green), anti-AstC (blue) and anti-Tk (white) antibodies in esg-Gal4ts>Notch RNAi, CCHa2-LexA>mCherry flies shift to 29 °C for 5-10 days after eclosion. Scale bar represents 25 μm.
In R1b-R2, only AstC+ and CCHa2+ EEs, but not Tk+ EEs were found in the EE clusters (Figure 3A-B), showing that the specification of class II EE is failed in these regions. For most EE clusters, we found that AstC+ EEs and CCHa2+ EEs were equally presented and mixed together in a salt and pepper fashion. Clusters containing more class III EEs and rare class I EEs were observed occasionally, but clusters containing only class I EEs were never observed (Figure 3A-B). Given these observations, it is tempting to speculate that the loss of Notch may not disrupt the asymmetric division of EEPs in R1b-R2 regions, but may cause them to generate class I/III or III/III EE pairs instead of class II/III or class II/I EE pairs.
In R4b, the EE clusters generated by Notch-depleted ISCs remained as AstC+ EE clusters, and a subset of these EEs (varying from 0-100%) were also positive for CCHa2 expression (Figure 3D). Therefore, the asymmetric pattern of CCHa2 expression appears to be remained despite the loss of Notch.
Taken together, these observations suggest that Notch is required for class II EE specification but not for class I nor III EEs, and it appears that Notch is not involved in the asymmetric cell division of EEPs to yield class I/III EE pairs in R2, nor in the asymmetric expression of CCHa2 within symmetric class I/I EE pairs in R4b.
Wnt morphogen gradient orchestrates regional patterning of class II EEs
We next investigated how the specific regional patterns of EE subtypes are established from pupal ISCs, especially in R1a, R1b-R2 and R4b regions. Given the gradual changes in the proportion of the three EE subtypes found in R1-R2 region (Figure 1G), we speculated that signaling gradients, such as WNT gradient, emanated from gut compartment boundaries, might be involved. It has been shown that the WNT ligand Wingless (Wg), which is expressed in the visceral muscle and the epithelial cells at several junctional regions, including the proventriculus-R1, R2-R3, and R5-hindgut boundaries, generates WNT signaling gradient and is important for the development of normal gut morphology and regulation of ISC proliferation 43–45. Consistent with the WNT gradient formation at the junctional regions, we found that WNT4 showed a similar expression pattern to Wg reflected by a GAL4 enhancer trap line (Figure S5A), and it is also similar for Wnt6 (data not shown). Moreover, we also found that in both pupal and adult midgut, fz3-RFP, a WNT activation reporter, showed a gradient pattern in the epithelium emanated from the junctions (Figure 4A and S5B-D). Its expression in ISCs is observed throughout the entire midgut and also displays a gradient that varies across different gut regions (Figure S5E).

WNT signaling gradient orchestrates regional class II EE specification.
(A) Midguts of fz3-RFP flies stained with anti-RFP (red) antibodies 5 days after eclosion. (B-G) Midguts stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red) in the following genotypes of flies driven by esg-Gal4ts for 8 days since 48h APF: WT (B-C), UAS-armS10 (D), UAS-nkd (E), UAS-TcfDN(F) and UAS-Tcf RNAi (G). (H-I) Quantification of the three major EE subtype percentage in R1a (H) and R4b (I) of WT, UAS-nkd, UAS-Tcf RNAi and UAS-armS10flies. Error bars represent Mean ± SEM, ****p <0.0001 (two-way ANOVA). (J-K) Midguts stained with anti-AstC (blue), anti-DH31 (green), anti-CCHa2 (red) and anti-Tk (white) in the following genotypes of flies driven by esg-Gal4ts for 10 days since 48h APF: WT (J-J’) and UAS-armS10 (K-K’). (L-M) Midguts stained with anti-AstC (blue), anti-NPF (green), anti-CCHa2 (red) and anti-Tk (white) in the following genotypes of flies driven by esg-Gal4ts for 10 days since 48h APF: WT (L-L’) and UAS-armS10 (M-M’). (N-O) Midguts stained with anti-AstC (blue), anti-AstA (green), anti-CCHa2 (red) and anti-Tk (white) in the following genotypes of flies driven by esg-Gal4ts for 10 days since 48h APF: WT (N-N’) and UAS-armS10 (O-O’). (P-Q) MARCM clones co-stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red). (P-P’’’) WT FRT82B clone, (Q-Q’’’) ApcG10Q8 FRT82B MARCM. Scale bar in (A): 500 μm; others: 50 μm.
To test if the WNT gradient is important for shaping regional pupal ISC identity and further influence the generation of the observed regional EE subtype patterns, we overexpressed a WNT pathway negative regulator nkd, or a dominant negative form of a WNT pathway effector Tcf (TcfDN), or RNAi of Tcf (Tcf-IR) in ISCs, started since early pupae stage (48h APF), and then examined the distribution pattern of class I, II and III EEs in the midgut 5 days after eclosion. We found that in all cases, although the pattern looked largely normal in most regions (Figure S5K-P), class III EEs were ectopically appeared in the R1a region (Figure 4B, 4E-G and S5F-I), and accounted for about 45% of the total EEs in R1a (Figure 4H), a proportion that is similar to that normally found in R1b and R2 regions. These observations suggest that a high level of WNT signaling activation may characterize the pupal ISC identity specific to the R1a region and facilitate the symmetric division of EEPs, thereby contributing to the formation of class II EE pairs in this region. Conversely, inhibition of WNT signaling may reduce its activity to a level comparable to that observed in the R1b-R2 regions, thereby facilitating asymmetric division of EEPs and resulting in the formation of class II/III EE pairs.
We next examined the effects of WNT signaling activation on class II EE fate specification and regional EE subtype patterns by overexpressed an active form of WNT signaling effector arm (armS10) (Figure S5J). We found that although the pattern remained largely normal in anterior and middle midgut (Figure S5K-N), the proportion of Tk+ class II EEs in posterior midgut were increased (Figure S5O-P), and ectopically appeared in the R4b region (Figure 4D and 4I), where they should be absent (Figure 4C). Normally class II EEs in R4-R5 regions can typically be distinguished from these in R1-R2 regions by their co-expression of the peptide hormone DH31, and class II EEs in R2-R3 region can typically be distinguished from those in other regions by their co-expression of the peptide hormone NPF 12. Virtually all of these ectopically appeared class II EEs in R4b co-expressed peptide hormone DH31 (Figure 4J-K) but not NPF (Figure 4L-M), suggesting that these EEs are not as a result of class II EE expansion from anterior and middle regions, but represent ectopic formation of class II EEs that similar to those in posterior regions. In addition, we found that the class I EEs in this region ectopically expressed peptide hormone Allatostatin A (AstA) (Figure 4N-O), which are normally expressed specifically in the R4c-R5 but not in R4b or other region or subregions 12. Taken together, these observations suggest that overactivation of WNT signaling causes the regional EE pattern of R4b region to resemble that of R4c-R5 region.
To further confirm the role of the WNT signaling pathway in the regulation of EE subtype fate, we used MARCM system to generate ApcQ8and Apc2g10 double mutant clones (abbreviated as Apcg10Q8) in which WNT signaling is hyperactivated 46. We found that Tk+ class II EEs specifically appeared in Apcg10Q8 homozygous clones, but not the wild type control clones in the R4b region (Figure 4P-Q), which further supports the notion that hyperactivation of WNT signaling activity is sufficient to promote the generation of class II EEs in R4b region, where these EEs are normally absent.
Therefore, it appears that a high level of WNT signaling favors the specification of Tk+ class II EE identity from pupal ISCs. Inhibition of WNT signaling results in the regional EE patterns of R1a region resembling those of R1b-R2, whereas overactivation of WNT signaling leads to the EE patterns of R4b region adopting characteristics typical of R4c-R5. However, suppression of WNT signaling does not produce fully reciprocal phenotypes in R4c-R5 region. One possible explanation is that additional regulatory mechanisms may cooperate with WNT signaling to modulate regional ISC identity and cell division mode.
BMP signaling negatively regulates class III EE specification and promotes class I/II EE pair mode
In addition to WNT, BMP is also recognized as an important morphogenetic factor. BMP-like Dpp is highly enriched at the boundary between posterior midgut and middle midgut in Drosophila and plays an essential role in the determination of R3 or copper cell region 33,34,47,48. Based on the expression of dad-LacZ, a BMP signaling activity reporter, the highest activity was found in the nuclei of epithelial cells within the R3 region at late pupae stage (Figure S6A). This activity was also seen both in R3 and R5 at the adult stage (Figure 5A and S6B), displaying a gradient pattern in the epithelium that emanates from these regions (Figure S6C). We therefore examined whether BMP signaling has a role in regulating regional EE patterns.

BMP signaling negatively regulate class III EE differentiation.
(A) Midguts of dad-LacZ flies stained with anti-LacZ (red) antibodies before eclosion. (B-E) Midguts stained with DAPI (blue), anti-2B10 (red) and anti-CCHa2 (white) in the following genotypes of flies driven by esg-Gal4ts for 8 days since 48h APF: WT (B), U-dad (C), U-TkvACT (D-E). (F-R) Midguts stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red) in the following genotypes of flies driven by esg-Gal4ts for 8 days since 48h APF: WT (F, J and M-O), UAS-dad (G and K), UAS-mad RNAi (H and L) and UAS-TkvACT(I and P-R). (S-W) Quantification of the three major EE subtype percentage in R1a (S), R2 (T), R3 (U), R4b (V) and R4c (W) of UAS-dad, UAS-mad RNAi and UAS-TkvACT flies. Error bars represent Mean ± SEM, *p <0.05; **p <0.01; ***p <0.001; ****p <0.0001 (two-way ANOVA). (X-Y) Midguts stained with anti-AstC (blue), anti-NPF (green), anti-CCHa2 (red) and anti-Tk (white) in the following genotypes of flies driven by esg-Gal4ts for 10 days since 48h APF: WT (X-X’) and UAS-TkvACT (Y-Y’). Scale bar in (A): 500 μm; (C): 100 μm; others: 50 μm.
We inhibited BMP signaling activity by overexpressing Dad, a BMP pathway negative regulator, or RNAi of BMP pathway effector mad (mad-IR) in ISCs started since early pupae stage (48h APF). Consistent with previous findings on the role for BMP signaling in copper cell specification 33, a significant reduction of 2B10+ (monoclonal antibody against Cut) Copper cell number were observed in the R3 region following BMP inhibition (Figure 5B-C). We found that although the regional EE pattern remained largely normal in posterior midgut (Figure 5V-W and S6H-I), the proportion of CCHa2+ class III EEs in R2 region were increased (Figure 5T), and even were found to ectopically appeared in R1a and R3, where they should be absent (Figure 5F-H, 5J-L, 5S, 5U and S6D-E). The proportion of these ectopic class III EEs was similar to that in the R2 region (Figure 5S-U). These results suggest that inhibition of BMP signaling partially induced pupal ISCs in R1a and R3 to adopt a cellular identity characteristic of R1b-R2 regions, thereby influencing EE subtype formation.
We further overexpressed an active form of BMP signaling effector Tkv (TkvACT) in pupal ISCs and found that, the cooper cell maker 2B10 was sporadically appeared in the epithelial cells in R4 (Figure 5D-E), and the EE subtype composition was significantly altered in all midgut compartments. Normally, CCha2 expression can be found in class III EEs in the R2 region (Figure 5M) and class I EEs in the R4b region (Figure 5N). However, in TkvACT guts, CCHa2 expression was virtually absent in all regions (Figure 5I, 5P-Q, 5S-V and S6F) except R4c, where CCha2+ but TK− and AstC− EEs, characteristics of class III EEs, appeared (Figure 5O, 5R and 5W). In all regions except R4c, EEs were all changed to a 1:1 composition of class I and class II EEs (Figure 5S-W and S6G-I). Moreover, NPF, which is normally expressed in class II EEs in R2-R3, was found to be expressed in all Tk+ class II EEs at R4b region in these BMP overactivated midgut (Figure 5X-Y), while peptide hormones specifically expressed in EEs at the posterior midgut, including DH31 (Figure S6J-M) and AstA (Figure S6N-Q), were not ectopically expressed at R2 and R4b regions, indicating that EEs in these regions have assumed the identity from R3, and the loss of CCHa2 expression precludes their transformation into the identity from R2. Collectively, these results suggest that BMP signaling negatively regulates the specification of CCHa2+ EEs in most gut regions and plays an essential role in the establishment of regional EE identity and diversity.
Manipulating WNT or BMP pathway activity in adult ISCs has a limited effect on regional EE diversity
So far, we have demonstrated that WNT and BMP signaling could modulate regional pupal ISC identity and thereby facilitating EE subtype specification in different gut regions. Previous studies have shown that regional ISC identity was established during a defined time window of metamorphosis. Regulating BMP signaling during the early pupal stage can transform ISC and enterocyte identity, while this transformation cannot be induced in adult midgut 34. To further investigate whether regional EE diversity could be changed in adult flies, we performed WNT and BMP signaling activity manipulation in adult ISCs by using esg-Gal4ts. We transferred 5-day-old adult flies to 29°C for 7 days, and then fed them with 5% DSS sucrose solution for 3 days and transferred back to standard food for 1-2 days, in order to induce stress and promote ISC proliferation to generate new EEs.
We observed that inhibiting either WNT signaling or BMP signaling did not alter the EE subtype composition in R1a (Figure S7A, S7F, and S7K). However, inhibiting BMP signaling could sporadically induce a few class III EEs in R3 (Figure S7B and S7G). On the other hand, activating WNT signaling could induce a small portion of Tk+ class II EEs in R4b (Figure S7D and S7L). Activating BMP signaling did not significantly influence the EE subtype composition in R2 and R4b, but could induce a very small portion of class III EEs in the R4c region (Figure S7C-E and S7H-J). These subtle alterations in the composition of EE subtypes suggest that, alterations in WNT and/or BMP signaling activity within adult ISCs have a very limited impact on the regional identity of ISCs responsible for generating EE subtypes.
Manipulating WNT or BMP pathway activity in the differentiated EEs has a mild effect on their subtype identity
We have previously shown that the differentiated EEs in adult midgut remain to be plastic as changes of their TF code can switch one EE subtype into another 49. To test if the regional EE identity can be altered by manipulating BMP or WNT signaling activities within differentiated EEs, we inhibited or activated pathway activities specifically in EEs by using prosV1-Gal4.
We observed that the inhibition of BMP signaling led to ectopic appearance of a small portion of class III EEs in R3, but not in other regions (Figure 6A-B, 6F-G and 6M-T). The activation of BMP signaling led to the loss of class III EEs in R2 (Figure 6C, 6H and 6N-O) and the ectopic appearance of class III EEs in R4c (Figure 6E, 6J and 6S). However, CCHa2+ class I EEs distributed in the posterior midgut were not affected (Figure 6D and 6I). Basically, the activation of BMP signaling caused a tendency of transforming into the composition pattern of class I/II EE throughout the whole gut regions except R4c (Figure 6M-T).

Manipulating WNT and BMP signaling in differentiated EEs has a mild impact on the regional specification of class II and III EEs.
(A-L) Midguts stained with anti-Pros (red), anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (green) in the following genotypes of flies driven by pros-Gal4: WT (A-E), UAS-dad (F-G), UAS-TkvACT (H-J), U-nkd (K) and U-armS10 (L). Yellow arrow heads in (I and L) represent ectopic class II EEs in R4b region, and blue arrow heads in (J) represent ectopic class III EEs in R4c region. Scale bar represents 25 μm. (M-T) Quantification of the three major EE subtype percentage in different gut regions of UAS-nkd, UAS-armS10, WT, UAS-dad and UAS-TkvACT flies. Error bars represent Mean ± SEM, **p <0.01; ***p <0.001; ****p <0.0001 (two-way ANOVA).
As for WNT signaling, inhibition of WNT activity did not significantly influence the EE composition in the whole gut (Figure 6A, 6K and 6M-T), but activation of WNT signaling induced ectopic appearance of a small portion of Tk+ class II EEs in R4b, and increased the percentage of class II EEs in R5 (Figure 6D, 6L and 6M-T). These phenotypes are similar but slightly weaker to those generated in ISCs initiated from the pupal stage. Therefore, BMP and WNT signaling gradients are not only important for establishing regional ISC identity and consequently contributing to the regional EE subtype diversity, but also play a role in maintaining regional diversity of differentiated EEs in adult midgut, reflecting the high plasticity of EEs.
A combinatorial activity of WNT and BMP signaling gradients orchestrates regional EE diversity
Since both WNT and BMP signaling pathways contribute to the diversity of pupal ISCs and regional EE subtypes, we investigated whether specific combinations of WNT and BMP activity levels play a key role in shaping regional ISC identity and EE diversity. We aligned and compared the distribution of EE subtypes and EEP division modes with the activation level of WNT and BMP signaling pathways in each region along the entire midgut (Figure 7M). We found that in R3-R4a and R4c-R5, where WNT and BMP signaling activity are relatively high, EEP divides asymmetrically to generate class II/I EE subtypes. Although activation of WNT signaling could increase proportion of class II EEs in R4c-R5, but inhibition of WNT signaling did not change the composition and proportion of EE subtypes in these regions (Figure S5M-P). However, inhibition of BMP signaling caused the ectopic appearance of class III EEs in R3, transforming the EE subtype composition into that of the R2 region (Figure 5J-L and 5U), and activation of BMP signaling widely induced the transformation of EE subtype composition into class II/I EE subtypes in each compartment (Figure 5S-W and S6G-I), indicating that a high level of BMP signaling, rather than WNT signaling, induces EEP to divide asymmetrically and generate the composition of class II/I EE subtypes.

WNT and BMP signaling cooperatively regulate regional EE diversity
(A) Midguts stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red) in esg-Gal4ts>U-nkd, U-TkvACT flies shift to 29 °C for 8 days since 48h APF. (B-F) Midguts stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red) in the following genotypes of flies driven by esg-Gal4ts for 8 days since 48h APF: WT (C-D) and UAS-armS10, UAS-TkvACT (B and E-F). (G) Midguts stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red) in esg-Gal4ts>U-dad, U-armS10 flies shift to 29 °C for 8 days since 48h APF. (H-L) Midguts stained with anti-AstC (blue), anti-Tk (white) and anti-CCHa2 (red) in the following genotypes of flies driven by esg-Gal4ts for 8 days since 48h APF: WT (L) and UAS-dad, UAS-nkd (H-K). (M) A schematic diagram describing the function of WNT and BMP gradients in regulating EEP division modes. (N) A schematic diagram on the relationships among EE subtype distribution pattern, WNT and BMP signaling activity and the EEP division modes along the fly midgut. Scale bar in (C) and (I): 50 μm; others: 300 μm.
To further test this hypothesis, we simultaneously induced the activation or inhibition of WNT and BMP signaling in pupal ISCs, and the induction time still started since early pupal stage (48h APF). We found when the BMP signaling was activated, regardless of whether combined with the activated or inhibited WNT signaling, the resulting phenotypes were similar to observed upon activating BMP signaling alone (Figure 5I, 5P-R, 5S-W, 7A-F and S6F-I), a condition under which a broad induction of class II/I EE subtype compositions occurred. Conversely, when the BMP signaling was inhibited, regardless of whether it was combined with the activated or inhibited WNT signaling, the phenotypic changes in the R3 region were similar to those of inhibiting BMP signaling alone (Figure 5J-L, 5U, 7G-H and 7J), a condition under which all three EE subtypes ectopically appeared in R3. These results suggest that, a high level of BMP signaling favors to induce asymmetric cell division of EEP to generate the composition of class II/I EE subtypes (Figure 7N).
We noticed that the composition of class II/I EE subtypes exist in the R3-R4a and R4c-R5 regions, but their peptide hormone profiles are significantly different 12. Inhibiting BMP signaling can transform the characteristics of R3 region, while activating BMP signaling widely induces other gut compartments to acquire the characteristics of the R3 region (Figure 5S-W), suggesting that a high level of BMP signaling establish the characteristics of the R3 region, while the characteristics of the R5 region may require precise activation levels of WNT and BMP signaling, or the involvement of additional unidentified mechanisms.
Next, we focused on the R1a region, where the WNT signaling is high, while BMP signaling is moderate or low, and EEP undergoes symmetric cell division to generate class II EEs (Figure 7M). We have found that inhibiting WNT signaling could induce the ectopic appearance of class III EEs in R1a (Figure 4E-G), leading to asymmetric cell division of EEP to produce class II/III EE subtypes, which indicated that high level of WNT signaling determined the characteristic of R1a region. However, inhibition of BMP signaling also results in a similar phenotype in R1a (Figure 5G-H), suggesting the involvement of BMP signaling. Indeed, inhibiting both WNT and BMP signaling simultaneously also led the ectopic appearance of class III EEs in R1a (Figure 7H-I). However, through genetic manipulation, we were unable to induce EEs in other gut regions to acquire the characteristics of R1a, perhaps because the establishment of the characteristic of R1a might require a precise combination of WNT and BMP signaling, that promote the generation of class II/II EEs via symmetric division of EEPs (Figure 7N).
Finally, we concentrated on the R4b region, in which the activities of both WNT and BMP signaling are low, and EEP undergoes symmetric division to generate class I/I EEs (Figure 7M). We have found that activating WNT signaling caused composition of EE subtypes R4b to transform into the composition pattern of class II/I subtypes (Figure 4D and 4I), and similar in BMP activated midguts (Figure 5Q and 5V). To further test the synergistic effect of WNT and BMP signaling, we simultaneously inhibited WNT and BMP signaling in pupal ISCs, and found that CCHa2+ class I EEs ectopically appeared in the R4a region, and class II EEs were completely lost, resulting in a pattern that all EEs became class I EEs (Figure 7K-L). Based on these observations, we propose that the combination of low WNT and BMP signaling level favors the generation of class I/I EEs from symmetric division of EEPs, a pattern normally found in the R4b region (Figure 7N).
Collectively, we propose that by default, class II, and I or III can be equally generated from ISCs via EEPs though Notch dependent (class II) and Notch-independent (class I and III) asymmetric cell divisions. WNT signaling activity favors the generation of class II EEs, while BMP signaling activity favors the generation of class I and against the generation of class III EEs (Figure 7M). As a result, the manifestation of EE subtype pattern in a specific gut region is, at least partially, governed by the intercalating levels of WNT and BMP signaling gradient emanating from the compartment boundaries (Figure 7N).
Discussion
Our study suggests a model for the establishment of regional EE diversity in the Drosophila midgut: The WNT and BMP morphogen gradients, which emanated from compartment boundaries during metamorphosis and adulthood, act globally and locally (interacting with Notch) to regulate the regional patterning of EE subtypes (Figure 7M-N). We propose that a combined activity of WNT and BMP gradients at specific intercalated sites determines the cell division mode of EEPs and consequently influence the cell fate of EE progenies: high BMP activity (BMPhigh) promotes class I and II EE specification through Notch-dependent asymmetric EEP division (R3); high WNT activity combined with moderate BMP signaling (WNThigh and BMPmedium) leads to the specification of class II EEs via symmetric EEP division (R1a); moderate levels of both WNT and BMP signaling (WNTmedium and BMPmedium) facilitate the generation of all three EE subtypes through two distinct Notch-dependent asymmetric EEP divisions (R1b-R2); and low levels of both pathways (WNTlow and BMPlow) favor the specification of class I EEs through symmetric EEP division (R4b).
However, several observations cannot be fully explained by the relative activities of WNT and BMP signaling. For example, the distinct expression patterns of CCHa2 and AstC in regions R1b– R2 and R4b–R4c, as well as the ectopic expression of CCHa2 in the R4c region under BMP hyperactivity, suggest additional regulatory influences. These findings indicate that other signaling pathways may be involved in specifying regional EE identity, particularly in distinguishing anterior from posterior regions. It is also worth noting that intrinsic mechanisms—such as region-specific transcription factor codes for EEs 12,41—may not be fully overridden by forced activation or inhibition of WNT and/or BMP signaling using the approaches employed in this study, potentially contributing to incomplete penetrance.
Our findings from the spatiotemporal manipulation of WNT and BMP signaling pathway further imply the significance of the intrinsic mechanisms—specifically, regional identity of ISCs—in determining regional EE diversity. This regional identity of ISCs is established during metamorphosis and cannot be efficiently altered after eclosion by manipulating WNT and BMP signaling activities. Additionally, ISCs located in different regions of the midgut surprisingly share an almost identical transcriptomic profile 50. These observations suggest that an epigenetic mechanism may underlie both the establishment and maintenance of regional ISC identity, as well as the regional characteristics of differentiated cells in adulthood. These results are consistent with previous findings indicating that BMP signaling overactivation enables efficient acquisition of gastric stem cell identity in the R3 region at the early pupal stage, but not in adult stages 34. In cases of injury or aging stress, extrinsic signals of the midgut undergo significant changes, such as the widespread activation of BMP signaling induced by bleomycin or pathogenic bacteria challenge 47,51. If the regional identity of ISCs is too readily and rapidly modifiable, it is conceivable that this could lead to disorders of intestinal epithelial compartmentation and potentially severe consequences such as metaplasia.
Interestingly, we found that manipulating WNT and BMP signaling in differentiated EEs can modify their regional identities to a certain extent. Our previous work has demonstrated that EEs exhibit a notable degree of cellular plasticity: alterations in their TF code—sometimes by modifying the expression of a single TF—can effectively switch their subtype identity 41. Extrinsic signaling cues, such as WNT and BMP gradients, may act to fine-tune these TF networks, thereby influencing EE identity. Thus, to a certain extent, differentiated EEs appear responsive to WNT and BMP morphogens, which may not only contribute to the maintenance of regional subtype identity under homeostatic conditions but also facilitate adaptive changes in cellular identity and peptide hormone expression in response to environmental and physiological demands.
Apart from the A/P axis, the mammalian gastrointestinal tract is more complex than that of Drosophila, with the addition of the axis along the villus and crypt. However, the conservation of intrinsic and extrinsic factors regulating ISC differentiation and EE subtype specification across Drosophila and mammals 6 further suggest that, WNT and BMP signaling may represent conserved mechanism for regulating regional EE diversity in both organisms. Studies have shown that EEs originating from the crypt can switch their subtype identity as they migrate upward along the villus-crypt axis, a phenomenon attributed to the BMP signaling gradients 52. Furthermore, treatment with BMP agonists in human intestinal organoids has been found to promote the generation of EE subtypes typically localized to the upper villus region, where BMP signal is the highest 52. Interestingly, despite the apparent plasticity of EEs, intestinal cells within cultured organoids or those transplanted into the colon, retain their original regional identity even after prolonged culture or transplantation 9,53–55. Collectively, these observations support the notion that the regional ISC identity is maintained postnatally through intrinsic mechanisms, while EEs remain plastic and responsive to extrinsic morphogen signals in both Drosophila and mammals. Our recent scRNA-seq analysis of Drosophila EEs has further classified the three major EE classes into 10 distinct subtypes, each characterized by the expression of a unique combination of 2–4 peptide hormones 12. This study establishes a foundation for enhancing the comprehension of the specification and regulatory mechanisms of EE subtypes in Drosophila. It is anticipated to contribute to the understanding of regional EE diversity and regulation in mammals and humans, thereby pave the way for the development of novel therapeutic strategies for enteroendocrine-related disorders and diseases, such as obesity and diabetes.
Materials and Methods
Fly strains and cultivation
The following fly strains were used in this study: CCHa2-Gal4 (BDSC, #84602); CCHa2-LexA (BDSC, #84962); Tk-Gal4 (BDSC, #84693); AstC-Gal4 (BDSC, #84595); GMR45D10-Gal4 (BDSC, #45323); GMR50A12-Gal4 (BDSC, #47618); GMR46B08-Gal4 (BDSC, #47361); esg-GAL4,UAS-GFP (gift from Shigeo Hayashi); prosV1-Gal4 (gift from Bruce Edgar); Wnt4-Gal4 (BDSC, #67449); fz3-RFP (BDSC, #92358); dad-LacZ (BDSC, #10305); UAS-mCD8:RFP (BDSC, #27398); LexAOP-GFP, UAS-RFP (BDSC, #32229); LexAOP-mCherry (BDSC, #52271); UAS-Notch RNAi (BDSC, #7078); UAS-scute (BDSC, #26687); UAS-nkd.GFP (BDSC, #25384); UAS-TcfDN (BDSC, #4785); UAS-Tcf RNAi (BDSC, #26743); UAS-armS10 (BDSC, #4782); UAS-dad.T (BDSC, #98452); UAS-mad RNAi (BDSC, #31315); UAS-TkvACT (gift from Chip Furguson); DlRevf10 (BDSC, #6300); ApcQ8, Apc2G10 (gift from Mark Peifer); 82B FRT; hsflp, Act-Gal4,UAS-EGFP; 82B FRT-Gal80 were all obtained from BDSC. Fly stocks were cultivated on standard food with yeast paste added on the food surface and kept at 25 °C unless otherwise stated.
The Gal4/UAS/Gal80ts or LexA-LexAOP systems were used to conduct conditional knocking down or overexpression in specific cell types 56–58. Unless otherwise stated, all crosses were performed at 18°C, and newly formed F1 pupae were collected and transferred to 29 °C to induce gene expression at 48h APF (corresponding to 25 °C).
To induce gut stress and promote EE pair formation, liquid food containing 5% DSS (MP Biomedicals, #160110) and 5% sucrose (Xilong Scientific, #57-50-1) was added to extra thick filter paper sheet (Bio-Rad, #1703966) and supplied to adult flies for 2-3 days at corresponding temperature.
Antibody generation
The mouse monoclonal anti-CCHa2, anti-DH31, anti-AstA and anti-NPF antibodies were custom made by Antibody Research Center in National Institute of Biological Sciences, Beijing. As described previously 59–61, a mature amidated CCHa2 peptide (GGGGSGCQAYGHVCYGGH-NH2), a full-length amidated DH31 peptide (CTVDFGLARGYSGTQEAKHRMGLAAANFAGGP-NH2), AstA peptide (NGGPGMKRLPVYNFGL-NH2) and full-length mature NPF (CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF-NH2) were synthesized and used for immunization separately. The peptides were injected into mice until the diluted raw sera showed immunostaining on Drosophila EEs. Following the fusion, hybridoma lines were screened by ELISA and immunostaining on Drosophila midgut, resulting in confirmed positives. The human monoclonal anti-CCHa2 was custom made by Biointron (Shanghai, China). variable region sequence of mAb was fished and recombinant expressed as human IgG.
Immunostaining
Immunostaining of Drosophila midgut was performed as previously described 45. In brief, 10-15 adult female flies for each sample were dissected in PBS and then fixed in 4% paraformaldehyde for 30 min at room temperature, followed by dehydration in methanol (for 5 min) and rehydration in PBT solution (PBS containing 0.1% Triton X-100, 5 min each for 3 times). The primary antibodies were added into 300 μl 5% NGS-PBT solution and incubate with sample for overnight at 4 °C. After washing three times using PBT, the secondary antibodies were added into 300 μl PBT and incubate with samples for 2 hours at room temperature, followed by staining of DAPI for 5 min. 80% glycerol was used to mount the samples and slides were kept in −20 °C freezer. Images were acquired on a Leica SP8 and Nikon AX inverted confocal microscopes. All images were assembled in Adobe Photoshop and Illustrator.
Primary antibodies used in this study were listed as follows: mouse anti-Pros (DSHB #MR1A; 1:300); rabbit anti-AstC 29 (gift from Dr. Jan A. Veenstra); guinea pig polyclonal anti-Tk 62 (gift from Dr. Eun Young Kim); rabbit polyclonal anti-β-galactosidase (Cappel, 0855976; 1: 6000); rabbit polyclonal anti-RFP (Rockland, 600-401-379; 1:400); rabbit monoclonal anti-GFP (Invitrogen, G10362; 1:600); mouse monoclonal anti-CCHa2 (this study; 1:300); human monoclonal anti-CCHa2 (this study; 1:300); mouse monoclonal anti-DH31 (this study; 1:300); mouse monoclonal anti-NPF (this study; 1:100); mouse monoclonal anti-AstA (this study; 1:200). Secondary antibodies used in this study include Alexa Fluor 405-conjugated donkey anti-mouse IgGs (Invitrogen, A148257; 1:300); Alexa Fluor 488- or 568-conjugated goat anti-mouse IgGs (Invitrogen, A11029, A11031; 1:300); Alexa Fluor 405-, 488-, 568- or Cy5-conjugated goat anti-rabbit IgGs (Invitrogen, A48254, A11034, A11036, A10523; 1:300); Alexa Fluor 488-, 568- or 647-conjugated goat anti-guinea pig IgGs (Invitrogen, A11073, A11075, A21450; 1:300); Alexa Fluor 633-conjugated goat anti-human IgGs (Invitrogen, A21091, 1:300) and DAPI (Sigma-Aldrich, 1μg/ml) was used for nuclei staining.
Statistical Analysis
Cell number counting and mean fluorescent intensity were performed using Image J, and all quantifications were presented in the form of mean±SEM. GraphPad Prism 8 software was used to calculate p-values by unpaired student’s t-test or two-way Anova test.
Acknowledgements
We thank Dr. Eun Young Kim for providing anti-Tk antibody, Dr. Jan-Adrianus Veenstra for anti-AstC antibody, Drs. Bruce Edgar, Chip Furguson, Shigeo Hayashi, Mark Peifer, Yi Rao for providing fly strains and the Bloomington Drosophila Stock Center (BDSC), the Tsinghua Fly Center, and Development Studies Hybridoma Bank (DSHB) and Antibody Center in NIBS for fly strains and antibodies, and members of the Xi laboratory for discussion and reading of the manuscript. This work was supported by National Key Research and Development Program of China (2020YFA0803502 and 2017YFA0103602 to R.X.) from the Chinese Ministry of Science and Technology. X.G. is supported by National Natural Science Foundation of China (Grant No. 32100595).
References
- 1.Gastrointestinal stem cells in health and disease: from flies to humansDisease Models & Mechanisms 9:487–499https://doi.org/10.1242/dmm.024232Google Scholar
- 2.Epithelial zonation along the mouse and human small intestine defines five discrete metabolic domainsNature Cell Biology 26:250–262https://doi.org/10.1038/s41556-023-01337-zGoogle Scholar
- 3.Stem cell mTOR signaling directs region-specific cell fate decisions during intestinal nutrient adaptationScience Advances 10https://doi.org/10.1126/sciadv.adi2671Google Scholar
- 4.Patterning the gastrointestinal epithelium to confer regional-specific functionsDevelopmental Biology 435:97–108https://doi.org/10.1016/j.ydbio.2018.01.006Google Scholar
- 5.Anatomy and Physiology of the Digestive Tract of Drosophila melanogasterGenetics 210:357–396https://doi.org/10.1534/genetics.118.300224Google Scholar
- 6.The specification and function of enteroendocrine cells in Drosophila and mammals: a comparative reviewThe FEBS Journal 289:4773–4796https://doi.org/10.1111/febs.16067Google Scholar
- 7.Function and mechanisms of enteroendocrine cells and gut hormones in metabolismNat Rev Endocrinol 15:226–237https://doi.org/10.1038/s41574-019-0168-8Google Scholar
- 8.A single-cell survey of the small intestinal epitheliumNature 551:333–339https://doi.org/10.1038/nature24489Google Scholar
- 9.High-Resolution mRNA and Secretome Atlas of Human Enteroendocrine CellsCell 181:1291–1306https://doi.org/10.1016/j.cell.2020.04.036Google Scholar
- 10.Identification of Enteroendocrine Regulators by Real-Time Single-Cell Differentiation MappingCell 176:1158–1173https://doi.org/10.1016/j.cell.2018.12.029Google Scholar
- 11.Single-cell messenger RNA sequencing reveals rare intestinal cell typesNature 525:251–255https://doi.org/10.1038/nature14966Google Scholar
- 12.The Cellular Diversity and Transcription Factor Code of Drosophila Enteroendocrine CellsCell Rep 29:4172–4185https://doi.org/10.1016/j.celrep.2019.11.048Google Scholar
- 13.Mechanisms controlling hormone secretion in human gut and its relevance to metabolismJ Endocrinol 244:R1–R15https://doi.org/10.1530/JOE-19-0399Google Scholar
- 14.Vagal sensory neurons and gut-brain signalingCurr Opin Neurobiol 62:133–140https://doi.org/10.1016/j.conb.2020.03.006Google Scholar
- 15.Mechanisms of Action and Therapeutic Application of Glucagon-like Peptide-1Cell Metab 27:740–756https://doi.org/10.1016/j.cmet.2018.03.001Google Scholar
- 16.The Discovery and Development of Liraglutide and SemaglutideFront Endocrinol (Lausanne) 10:155https://doi.org/10.3389/fendo.2019.00155Google Scholar
- 17.Intestinal renewal across the animal kingdom: comparing stem cell activity in mouse and DrosophilaAmerican Journal of Physiology-Gastrointestinal and Liver Physiology 316:G313–G322https://doi.org/10.1152/ajpgi.00353.2018Google Scholar
- 18.Physiological and Pathological Regulation of Peripheral Metabolism by Gut-Peptide Hormones in DrosophilaFront Physiol 11:577717https://doi.org/10.3389/fphys.2020.577717Google Scholar
- 19.Morphological and molecular characterization of adult midgut compartmentalization in DrosophilaCell Rep 3:1725–1738https://doi.org/10.1016/j.celrep.2013.04.001Google Scholar
- 20.Physiological and stem cell compartmentalization within the Drosophila midguteLife 2https://doi.org/10.7554/eLife.00886Google Scholar
- 21.The adult Drosophila posterior midgut is maintained by pluripotent stem cellsNature 439:470–474https://doi.org/10.1038/nature04333Google Scholar
- 22.Evidence that stem cells reside in the adult Drosophila midgut epitheliumNature 439:475–479https://doi.org/10.1038/nature04371Google Scholar
- 23.Transient Scute activation via a self-stimulatory loop directs enteroendocrine cell pair specification from self-renewing intestinal stem cellsNat Cell Biol 20:152–161https://doi.org/10.1038/s41556-017-0020-0Google Scholar
- 24.Apical-basal polarity precisely determines intestinal stem cell number by regulating Prospero thresholdCell Reports 42https://doi.org/10.1016/j.celrep.2023.112093Google Scholar
- 25.A cell atlas of the adult Drosophila midgutProc Natl Acad Sci U S A 117:1514–1523https://doi.org/10.1073/pnas.1916820117Google Scholar
- 26.A Systematic Analysis of Drosophila Regulatory Peptide Expression in Enteroendocrine CellsMol Cells 39:358–366https://doi.org/10.14348/molcells.2016.0014Google Scholar
- 27.Spatiotemporal organization of enteroendocrine peptide expression in DrosophilaJ Neurogenet 35:387–398https://doi.org/10.1080/01677063.2021.1989425Google Scholar
- 28.Interorgan communication through peripherally derived peptide hormones in DrosophilaFly (Austin) 16:152–176https://doi.org/10.1080/19336934.2022.2061834Google Scholar
- 29.Regulatory peptides in fruit fly midgutCell Tissue Res 334:499–516https://doi.org/10.1007/s00441-008-0708-3Google Scholar
- 30.More Drosophila enteroendocrine peptides: Orcokinin B and the CCHamides 1 and 2Cell Tissue Res 357:607–621https://doi.org/10.1007/s00441-014-1880-2Google Scholar
- 31.The sugar-responsive enteroendocrine neuropeptide F regulates lipid metabolism through glucagon-like and insulin-like hormones in Drosophila melanogasterNat Commun 12:4818https://doi.org/10.1038/s41467-021-25146-wGoogle Scholar
- 32.The gut hormone Allatostatin C/Somatostatin regulates food intake and metabolic homeostasis under nutrient stressNat Commun 13:692https://doi.org/10.1038/s41467-022-28268-xGoogle Scholar
- 33.Dpp signaling determines regional stem cell identity in the regenerating adult Drosophila gastrointestinal tractCell Rep 4:10–18https://doi.org/10.1016/j.celrep.2013.05.040Google Scholar
- 34.Specification of regional intestinal stem cell identity during Drosophila metamorphosisDevelopment 141:1848–1856https://doi.org/10.1242/dev.104018Google Scholar
- 35.Generation of enteroendocrine cell diversity in midgut stem cell lineagesDevelopment 142:654–664https://doi.org/10.1242/dev.114959Google Scholar
- 36.Development of the Drosophila entero-endocrine lineage and its specification by the Notch signaling pathwayDev Biol 353:161–172https://doi.org/10.1016/j.ydbio.2011.01.039Google Scholar
- 37.Identification of adult midgut precursors in DrosophilaGene Expr Patterns 11:12–21https://doi.org/10.1016/j.gep.2010.08.005Google Scholar
- 38.Bidirectional Notch signaling regulates Drosophila intestinal stem cell multipotencyScience 350https://doi.org/10.1126/science.aab0988Google Scholar
- 39.Tissue damage-induced intestinal stem cell division in DrosophilaCell Stem Cell 4:49–61https://doi.org/10.1016/j.stem.2008.10.016Google Scholar
- 40.A Phyllopod-Mediated Feedback Loop Promotes Intestinal Stem Cell Enteroendocrine Commitment in DrosophilaStem Cell Reports 10:43–57https://doi.org/10.1016/j.stemcr.2017.11.014Google Scholar
- 41.A hierarchical transcription factor cascade regulates enteroendocrine cell diversity and plasticity in DrosophilaNat Commun 13:6525https://doi.org/10.1038/s41467-022-34270-0Google Scholar
- 42.Mosaic Analysis with a Repressible Cell Marker for Studies of Gene Function in Neuronal MorphogenesisNeuron 22:451–461https://doi.org/10.1016/s0896-6273(00)80701-1Google Scholar
- 43.Regulation of Stem Cell Proliferation and Cell Fate Specification by Wingless/Wnt Signaling Gradients Enriched at Adult Intestinal Compartment BoundariesPLoS Genet 12:e1005822https://doi.org/10.1371/journal.pgen.1005822Google Scholar
- 44.Essential long-range action of Wingless/Wnt in adult intestinal compartmentalizationPLoS Genet 15:e1008111https://doi.org/10.1371/journal.pgen.1008111Google Scholar
- 45.Paracrine Wingless signalling controls self-renewal of Drosophila intestinal stem cellsNature 455:1119–1123https://doi.org/10.1038/nature07329Google Scholar
- 46.APC loss-induced intestinal tumorigenesis in Drosophila: Roles of Ras in Wnt signaling activation and tumor progressionDev Biol 378:122–140https://doi.org/10.1016/j.ydbio.2013.03.020Google Scholar
- 47.Injury-induced BMP signaling negatively regulates Drosophila midgut homeostasisJ Cell Biol 201:945–961https://doi.org/10.1083/jcb.201302049Google Scholar
- 48.Defective Proventriculus Regulates Cell Specification in the Gastric Region of Drosophila IntestineFrontiers in Physiology 11https://doi.org/10.3389/fphys.2020.00711Google Scholar
- 49.Cell-fate conversion of intestinal cells in adult Drosophila midgut by depleting a single transcription factorNat Commun 15:2656https://doi.org/10.1038/s41467-024-46956-8Google Scholar
- 50.Regional Cell-Specific Transcriptome Mapping Reveals Regulatory Complexity in the Adult Drosophila MidgutCell Reports 12:346–358https://doi.org/10.1016/j.celrep.2015.06.009Google Scholar
- 51.Dpp/Gbb signaling is required for normal intestinal regeneration during infectionDevelopmental Biology 399:189–203https://doi.org/10.1016/j.ydbio.2014.12.017Google Scholar
- 52.Enteroendocrine cells switch hormone expression along the crypt-to-villus BMP signalling gradientNat Cell Biol 20:909–916https://doi.org/10.1038/s41556-018-0143-yGoogle Scholar
- 53.Human Intestinal Organoids Maintain Self-Renewal Capacity and Cellular Diversity in Niche-Inspired Culture ConditionCell Stem Cell 23:787–793https://doi.org/10.1016/j.stem.2018.11.016Google Scholar
- 54.Adult stem cells in the small intestine are intrinsically programmed with their location-specific functionStem Cells 32:1083–1091https://doi.org/10.1002/stem.1655Google Scholar
- 55.Small intestinal stem cell identity is maintained with functional Paneth cells in heterotopically grafted epithelium onto the colonGenes Dev 28:1752–1757https://doi.org/10.1101/gad.245233.114Google Scholar
- 56.Targeted gene expression as a means of altering cell fates and generating dominant phenotypesDevelopment 118:401–415Google Scholar
- 57.Spatiotemporal gene expression targeting with the TARGET and gene-switch systems in DrosophilaSci STKE 2004:l6Google Scholar
- 58.Genetic mosaic with dual binary transcriptional systems in DrosophilaNat Neurosci 9:703–709https://doi.org/10.1038/nn1681Google Scholar
- 59.More Drosophila enteroendocrine peptides: Orcokinin B and the CCHamides 1 and 2Cell and Tissue Research 357:607–621https://doi.org/10.1007/s00441-014-1880-2Google Scholar
- 60.Calcitonin gene-related peptide neurons mediate sleep-specific circadian output in DrosophilaCurr Biol 24:2652–2664https://doi.org/10.1016/j.cub.2014.09.077Google Scholar
- 61.Expression of the allatostatin gene in endocrine cells of the cockroach midgutProc Natl Acad Sci U S A 91:11894–11898https://doi.org/10.1073/pnas.91.25.11894Google Scholar
- 62.Metabolic control of daily locomotor activity mediated by tachykinin in DrosophilaCommun Biol 4:693https://doi.org/10.1038/s42003-021-02219-6Google Scholar
Article and author information
Author information
Version history
- Sent for peer review:
- Preprint posted:
- Reviewed Preprint version 1:
Cite all versions
You can cite all versions using the DOI https://doi.org/10.7554/eLife.108542. This DOI represents all versions, and will always resolve to the latest one.
Copyright
© 2025, Lv et al.
This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.
Metrics
- views
- 413
- downloads
- 18
- citation
- 1
Views, downloads and citations are aggregated across all versions of this paper published by eLife.