Main text

Tsai M-F, Phillips CB, Ranaghan M, Tsai C-W, Wu Y, Williams C, Miller C. 2016. Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex. eLife 5:e15545. doi: 10.7554/eLife.15545.

Published 21, April 2016

The protein sequence of EMRE from D. melanogaster, sequence #13 in Supplementary file 1, was incorrect due to a mistaken copy-and-paste while preparing the manuscript. The correct D. melanogaster sequence is now entered in the corrected Supplementary file 1. We are grateful to J. Agapite, a curator of FlyBase, who noticed the error and reported it to the senior author.

This error did not affect any results or conclusions of the paper.

Incorrect sequence:

MTSKTVFQNAFKTFLDFAINSLPSTQGGLNITATAPGGVGQRPFTNKAGVLKLIFVSASSLYIGGLIAHKGASYLEENEIFVPTDEDDDD

Corrected sequence:

MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED

The article has been corrected accordingly.

Article and author information

Author details

  1. Ming-Feng Tsai

  2. Charles B Phillips

  3. Matthew Ranaghan

  4. Chen-Wei Tsai

  5. Yujiao Wu

  6. Carole Willliams

Version history

  1. Received:
  2. Accepted:
  3. Version of Record published:

Copyright

© 2017, Tsai et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.

Metrics

  • 435
    views
  • 1
    downloads
  • 1
    citation

Views, downloads and citations are aggregated across all versions of this paper published by eLife.

Citations by DOI

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Open citations (links to open the citations from this article in various online reference manager services)

Cite this article (links to download the citations from this article in formats compatible with various reference manager tools)

  1. Ming-Feng Tsai
  2. Charles B Phillips
  3. Matthew Ranaghan
  4. Chen-Wei Tsai
  5. Yujiao Wu
  6. Carole Willliams
  7. Christopher Miller
(2017)
Correction: Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex
eLife 6:e26228.
https://doi.org/10.7554/eLife.26228

Share this article

https://doi.org/10.7554/eLife.26228