Correction: Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex
Main text
Tsai M-F, Phillips CB, Ranaghan M, Tsai C-W, Wu Y, Williams C, Miller C. 2016. Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex. eLife 5:e15545. doi: 10.7554/eLife.15545.
Published 21, April 2016
The protein sequence of EMRE from D. melanogaster, sequence #13 in Supplementary file 1, was incorrect due to a mistaken copy-and-paste while preparing the manuscript. The correct D. melanogaster sequence is now entered in the corrected Supplementary file 1. We are grateful to J. Agapite, a curator of FlyBase, who noticed the error and reported it to the senior author.
This error did not affect any results or conclusions of the paper.
Incorrect sequence:
MTSKTVFQNAFKTFLDFAINSLPSTQGGLNITATAPGGVGQRPFTNKAGVLKLIFVSASSLYIGGLIAHKGASYLEENEIFVPTDEDDDD
Corrected sequence:
MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED
The article has been corrected accordingly.
Article and author information
Author details
Version history
- Received:
- Accepted:
- Version of Record published:
Copyright
© 2017, Tsai et al.
This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.
Metrics
-
- 435
- views
-
- 1
- downloads
-
- 1
- citation
Views, downloads and citations are aggregated across all versions of this paper published by eLife.
Citations by DOI
-
- 1
- citation for umbrella DOI https://doi.org/10.7554/eLife.26228