Abstract
Summary
DNA base lesions, such as incorporation of uracil into DNA or base mismatches, can be mutagenic and toxic to replicating cells. To discover factors in repair of genomic uracil, we performed a CRISPR knockout screen in the presence of floxuridine, a chemotherapeutic agent that incorporates uracil and fluoro-uracil into DNA. We identified known factors, such as uracil DNA N-glycosylase (UNG), but also unknown factors, such as the N6-adenosine methyltransferase, METTL3, as required to overcome floxuridine-driven cytotoxicity. Visualized with immunofluorescence, the product of METTL3 activity, N6-methyladenosine, formed nuclear foci in cells treated with floxuridine. The observed N6-methyladenosine was embedded in DNA, called 6mA, which was confirmed using mass spectrometry. METTL3 and 6mA were required for repair of lesions driven by additional base damaging agents, including raltitrexed, gemcitabine, and hydroxyurea. Our results establish a role for METTL3 and 6mA to promote genome stability in mammalian cells, specially in response to base damage.
Introduction
DNA base lesions, including incorporation of uracil into DNA and base mismatches, can be mutagenic, and potentially toxic, to replicating cells (reviewed in 1). Uracil can be incorporated into the genome through several means, including DNA replication, cytosine deamination, and exposure to FDA-approved chemotherapeutic agents, such as fluorouracil (5-FU) and floxuridine, which can introduce uracil (U) and fluoro-uracil (FU) into the genome as U:G, U:A, FU:G, or FU:A pairs 2,3 and are commonly used for treatment of solid tumors, in particular gastrointestinal cancers such as colorectal cancer (CRC).
Removal of uracil and downstream DNA repair are necessary to maintain genome integrity. Genomic uracil is removed through two molecular pathways, uracil base excision repair (U-BER) and mismatch repair (MMR) 2,3(reviewed in 4). U-BER plays a predominant role, and it depends on uracil DNA N-glycosylase (UNG), a highly conserved enzyme that cleaves the N-glycosylic bond between an uracil or fluoro-uracil base and the DNA backbone, whether in U:A, U:G, FU:A, or FU:G pairs. UNG is expressed as two isoforms with different N-terminal regions, UNG1 and UNG2. UNG1 localizes to the mitochondria while UNG2 localizes to the nucleus.5 The N-terminal extension of UNG2 contains residues required for nuclear localization and is the isoform of interest in this paper. MMR plays a secondary role and depends on MutSα, a heterodimer composed of Mut S Homolog 2 (MSH2) and Mut S Homolog 6 (MSH6), which recognizes single nucleotide mismatches in DNA relevant to uracil removal (U:G and FU:G). MutSα can also recognize U:A and FU:A pairs, albeit with low efficiency 2,6. Following initial damage recognition by UNG or MutSα, many additional factors cooperate to return the genome to its original state (reviewed in 4,7).
Understanding the molecular mechanisms of uracil repair is therapeutically relevant. For example, U-BER and MMR pathways can counteract the efficacy of chemotherapy 3, and thus they may include targets for clinical applications (reviewed in 8). Additionally, the coordination of uracil repair in response to programmed cytosine deamination in B cells is vital for normal antibody maturation, and alterations in these repair pathways can lead to cancer development or immunodeficiencies (reviewed in 9). While removal of uracil from DNA has been historically understood in terms of the U-BER and MMR pathways, in this study, we took an unbiased, genome-wide approach to identify novel factors involved in uracil repair with potential clinical interest, including factors involved in methylation of adenosine at the N6 position.
The N6-adenosine methyltransferase complex is composed of methyltransferase-like 3 (METTL3), methyltransferase-like 14 (METTL14) and Wilms tumor 1-associated protein (WTAP). METTL3 contains a functional methyltransferase domain belonging to the MT-A70 family of S-adenosyl-methionine-dependent methyltransferases and is well-studied for its ability to methylate adenosine at the N6-position in RNA 10. The literature suggests that METTL3 functions in DNA damage responses, with METTL3-dependent methylation of adenosine on RNA occurring in response to damage induced by UV and 5-FU 11,12. Moreover, METTL3 has been shown to interact with mismatch repair factors, MSH2 and MSH6 13 in co-immunoprecipitation studies, while functional analyses reveal that METTL3 is involved in MMR 14. To date, these results have primarily been interpreted based on METTL3’s well-known ability to modify RNA and modulate mRNA stability in a N6-adenosine methyltransferase-dependent manner (reviewed in 15).
Consistent with our functional genomics data, discovery proteomics also revealed that components of the N6-adenosine methyltransferase complex can associate with UNG2. Thus, we sought to investigate the role of N6-adenosine methyltransferases in uracil repair. We observed increased sensitivity to floxuridine upon knockout of METTL3. Additionally, an inhibitor of METTL3 sensitized cells to floxuridine, suggesting that the product of METTL3 activity, N6-methyladenosine (m6A referring to the RNA-embedded species, 6mA referring to the DNA-embedded species), is important in repair of uracil-based damage. Repair of DNA lesions is often accompanied by the formation of “repair foci,” which represent the enrichment of DNA repair factors at damaged sites. We found that nuclear, METTL3-dependent N6-methyladenonsine foci formed in cells treated with uracil-based damaging agents. While m6A is a well-established RNA modification, strikingly, we discovered that uracil-based DNA damage led to 6mA deposition in DNA. We show that METTL3 and 6mA facilitate repair of damage caused by uracil-based chemotherapeutic agents, functioning upstream of UNG2 in U-BER. Additionally, we establish a broader role for METTL3 and 6mA in DNA repair, specifically in responding to base damage beyond uracil incorporation. We propose this ubiquitous function in base damage is due to a role of 6mA in MMR. This is the first evidence of a mechanistic link between 6mA deposition in DNA and DNA repair in mammalian cells.
Results
N6-adenosine-methyltransferases function in repair of floxuridine-induced DNA lesions
To identify modulators of response to floxuridine-induced DNA lesions, we performed a whole genome Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) knockout screen in HT-29 cells, a mismatch repair (MMR)-proficient colorectal cancer cell line (Figure 1A, B Supplementary Table 1). We found that knockout of ∼2.6% of the genes tested significantly sensitized HT-29 cells to floxuridine. UNG, targeted with guides that cut both isoforms, was identified as a top hit validating that the screen was successful (Figure 1A, B). Genes sensitizing cells to floxuridine were associated with DNA repair and replication pathways (Figure 1C). Known factors in repair of uracil lesions, including downstream repair factors in base excision repair (BER), such as apurinic/apyrimidinic endodeoxyribonuclease 1 (APEX1) and Ligase 1 (LIG1), and MMR factors, such as MSH2 and exonuclease 1 (EXO1), were among those identified as hits (Figure 1A-C). The identification of the above pathways and factors provides increased confidence in the validity of the screen. Interestingly, we also observed that the loss of METTL3, METTL14, and methyltransferase-like 4 (METTL4), sensitized cells to floxuridine (Figure 1A, B). N6-adenosine methyltransferases have not previously been implicated in U-BER.

Whole genome CRISPR screen identifies N6-methyltransferases in repair of floxuridine-induced DNA lesions.
(A) Schematic of whole genome CRISPR screen in HT-29 cells reported in B. (B) Volcano plot displaying MAGeCK gene level log2(fold change) for each gene in treated and untreated arms versus -log10(p-value). Cut-off displays genes with log2(fold change) >|0.5| and -log10(p-value) >2. Genes whose loss sensitizes cells to floxuridine skew to the left. Non-targeting guides are shown in light gray and fall below cut-off values. Essential genes also performed as expected, dropping out at later time points (data not shown). (C) KEGG pathway analysis for genes that sensitize cells to floxuridine with log2(fold change) >|0.5| and -log10(p-value) >2. Flox, floxuridine; FDR, false discovery rate
In a complementary investigation into repair of uracil-based DNA lesions, we immunoprecipitated endogenous UNG2 and identified co-purifying factors by liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). Experiments were performed in the absence or presence of floxuridine to establish networks of factors that interact with UNG2 at baseline or under DNA damage conditions, respectively. Co-immunoprecipitations of UNG2 identified known BER factors, such as LIG1, but also WTAP, a key member of the N6-adenosine methyltransferase complex, which was identified in both conditions (Supplementary Table 2). These data reinforce the notion that N6-methyladenosine-depositing enzymes are relevant for UNG2 activity.
While UNG2 is well-studied for its enzymatic role in repair of uracil-containing DNA, the dynamics of UNG2’s cellular localization in response to uracil-based DNA damage are incompletely understood. We found that UNG2 forms nuclear foci upon treatment with floxuridine (Figure 2A, B). In these experiments, an UNG2 cDNA construct was tagged with mCherry and expressed in UNG knockout (KO) DLD-1 cells, where both isoforms of UNG were targeted (Figure S1A-C). Both wild type DLD-1 cells and UNG KO cells exhibit about 30% of cells in S phase at baseline (Figure S2A). Using this system, we observed a significant increase in the percentage of cells with mCherry (UNG2) foci in response to uracil-based DNA damage. When cells were treated with increasing concentrations of floxuridine, nuclear foci were visualized in UNG2 expressing cells, but not in cells expressing mCherry alone (EV) (Figure 2A, B). Comparable results were observed upon treatment with raltitrexed, an inhibitor of thymidylate synthase that also increases genomic uracil (Figure S2B, C). Additionally, the percentage of cells with UNG2 foci was also increased when cells were treated with hydroxyurea (HU), a ribonucleotide reductase inhibitor that alters nucleotide pools, but not gemcitabine, a cytosine analog, or mitomycin C (MMC), an interstrand crosslinker (Figure S2D, E). To assess whether DNA damage levels were linked to the ability of cells to form UNG2 foci, we quantified the mean nuclear γH2AX intensity after each treatment. γH2AX serves as a marker for DNA damage, specifically ssDNA and dsDNA breaks. The levels of DNA damage, as measured by mean nuclear γH2AX staining, did not correlate with the percentage of cells displaying UNG2 foci (Figure S2F, G). Together, these data suggest that UNG2 foci do not form as a general response to DNA damage and are specific to uracil-based DNA damage.

Discovery-based proteomics identifies N6-methyltransferases at sites of UNG2-seeded condensates.
(A) Representative images from DLD-1 UNG KO cells expressing indicated mCherry-tagged cDNAs upon treatment with increasing concentrations of floxuridine at 64 hours post treatment.
(B) Quantification of experiment represented in A for percentage of cells with >5 mCherry foci.
Error bars, mean ± SEM; Ordinary one-way ANOVA with Dunnett’s multiple comparisons test with a single pooled variance, ∗∗∗p ≤ 0.001, n = 3 biological replicates. Statistical tests performed within individual groups, EV or UNG2, respectively. (C) PONDR VSL2 plot of disorder for UNG2.
(D) Representative schematic of mutant UNG2 cDNA constructs expressed in UNG KO DLD-1 cells in E. IDR only cDNA lacks amino acids 93, ΔIDR cDNA lacks amino acids 1-92, and IDR-C cDNA moved amino acids 1-92 to the C-terminus. (E) Representative images from DLD-1 UNG KO cells expressing indicated mCherry-Cry2-tagged cDNAs without or with stimulation of blue light for 60 seconds. While ΔIDR and EV images display cytoplasmic foci, these lack the distinct nuclear foci patterning observed for UNG2, IDR, and IDR-C constructs. (F) Schematic of proximity biotinylation of IDR interaction partners in cells. (G). Venn diagrams of factors identified by stable isotope labeling of amino acids in cell culture (SILAC)-based mass spectrometry (MS) with 1>log2(L/H), reflecting a 4-fold enrichment in UNG-IDR/Control, from two biological replicates. n.s., non-statistically significant; Flox, floxuridine; EV, empty vector; IDR, intrinsically disordered region
Biomolecular condensates, defined as the coalescence of protein and nucleic acids via multivalent interactions, have emerged as an important organization principle inside cells, in absence of membranes. Condensates regulate many cell processes, including DNA repair (reviewed in 16–19). Thus, we hypothesized that uracil-induced UNG2 foci may represent functional condensates that concentrate factors required for uracil removal and DNA repair. Condensates formation is often driven by intrinsically disordered regions (IDRs) within proteins (reviewed in 16–19). The N-terminal region of UNG (amino acids 1-92) contains an IDR as calculated by Predictor of Natural Disordered Regions (PONDR) (Figure 2C) and previous reports indicate that the same region is partially required for UNG2’s localization to laser-induced DNA damage 20. Thus, we sought to assess whether UNG2’s IDR allows UNG to form biomolecular condensates using the optoDroplet system where an IDR of choice is fused to the photolyase homology region of Arabidopsis thaliana Cry2, a light-sensitive protein which self-associates upon blue light exposure21. This method measures, in a tunable manner, the propensity of a given polypeptide to seed condensates upon light irradiation, in absence of functional stimuli like DNA damage. We generated a panel of mutated UNG2 constructs fused to mCherry-Cry2, including full length UNG2 (UNG2), UNG2 IDR only (IDR), UNG2 lacking the IDR (ΔIDR), UNG2 IDR moved to the C-terminus (IDR-C), and an empty vector (EV) containing only the mCherry-Cry2 construct (Figure 2D). UNG2 full length, IDR, and IDR-C constructs expressed in UNG2 KO cells formed nuclear foci upon exposure to blue light, whereas the ΔIDR and EV constructs did not (Figure 2E). This suggests that UNG2’s IDR is capable of seeding condensates. Within the IDR region of UNG2, there is a PCNA-binding and an RPA-binding domain. To assess the contribution of these domains, we also generated UNG2 constructs that lacked the PCNA interacting peptide (ΔPIPF10,11A) or ability to bind RPA (ΔRPAR88C) and found that the ΔPIP construct formed nuclear foci upon exposure to blue light while the ΔRPA construct did not (Figure 2E).
To evaluate whether propensity to form condensates was correlated to UNG2-dependent DNA repair, we sought to explore the ability of the same UNG2 constructs to complement the floxuridine sensitivity of UNG KO cells (Figure S2H). UNG KO cells expressing UNG2, IDR-C, ΔPIP, and ΔRPA constructs rescued the sensitivity of UNG KO cells to floxuridine (Figure S2H), confirming that these constructs are functional. Interesting, taken together with the optoDroplet data, this suggests that RPA binding may be required during S phase, but additional regions of the protein may compensate to direct repair during DNA damage conditions. The IDR-only construct lacks UNG’s catalytic domain and unsurprisingly was not able to complement floxuridine-induced cytotoxicity. UNG KO cells expressing the ΔIDR construct showed an intermediate phenotype (Figure S2I). Together, these data suggest that UNG2’s IDR can seed biomolecular condensates and is partially required for UNG2-dependent floxuridine repair.
Based on the premise that UNG2 can form biomolecular condensates, we used an in-cell proximity biotinylation assay to identify factors enriched in UNG2-IDR-seeded condensates 22; De La Cruz et. al., unpublished, Sabari Lab). In this assay, a UNG2-IDR cDNA was fused to a LacI construct and biotinylating enzyme ascorbic acid peroxidase 2 (APEX2) and expressed in U2OS 2-6-3 cells. The LacI module allowed for recruitment of multiple copies of UNG2-IDR to a particular genomic locus where a LacO array is integrated, resulting in high local concentrations of UNG2-IDR that are sufficient to seed a condensate (Figure 2F). At this locus, factors present in UNG2-IDR-seeded condensates were biotinylated by APEX2, purified, and identified by LC-MS/MS (Figure 2F) 23,24. As expected, we identified peptides mapping to UNG2-IDR itself (Figure 2G, Supplementary Table 3). Similar to our functional genomics screen observations, proteins that were present in UNG2-IDR-seeded condensates were also enriched in DNA repair and replication pathways (Figure S2H). This included downstream repair factors in BER, such as LIG1, and MMR factors such as MSH2, as well as single-stranded binding protein, and replication protein A2 (RPA2), a known UNG interacting partner 25–27. (Figure 2G, Supplementary Table 3). This raises the possibility that through UNG2-IDR’s interaction with RPA, other DNA repair factors may be recruited through indirect interaction via RPA rather than directly through the IDR. Remarkably, the recruitment of DNA repair factors by UNG2-IDR-seeded condensates occurred in the absence of UNG2’s catalytic domain and uracil-based damage, suggesting that UNG2-IDR is sufficient to recruit repair factors relevant for U-BER. Importantly, peptides for both METTL3 and METTL14 were also identified as enriched in UNG2-IDR-seeded condensates (Figure 2G, Supplementary Table 3). This is consistent with a described role for METTL3 and METTL14 in the formation of condensates 28,29, and provides additional evidence that N6-adenosine methyltransferases may cooperate with UNG2 in uracil repair.
METTL3 deposits 6mA in DNA in response to agents that increase genomic uracil
Given the identification of N6-adenonsine methyltransferases in orthogonal discovery-based methods related to repair of uracil-containing DNA, we sought to examine the contribution of METTL3 and its substrate, N6-methyladenosine, to uracil repair. First, we validated the findings of the functional genomics screen. Consistent with the screen results obtained in MMR-proficient HT-29 cells (Figure 1A, B), METTL3 KO sensitized DLD-1 cells, an MMR-deficient colorectal carcinoma cell line, to floxuridine (Figure 3A, B). This suggests that the role of METTL3 in uracil repair is independent of MMR status. To determine whether the methyltransferase activity of METTL3 is important for its role in uracil repair, we assessed the sensitivity of DLD-1 and SW620 cells to floxuridine in absence or presence of a tool inhibitor for METTL3 30. Treatment with the METTL3 inhibitor increased floxuridine sensitivity in both cell lines, suggesting that METTL3 methyltransferase activity is important for its function in repair of floxuridine-induced lesions (Figure 3C, S3A). We also found that knockout of WTAP sensitized cells to floxuridine, but to a lesser extent than knockout of METTL3 (Figure S3B, C).

METTL3 deposits N6-methyladenonsine in DNA in response to agents that increase genomic uracil.
(A) Representative immunoblot images from DLD-1 cells nucleofected with ribonucleoproteins containing Cas9 and indicated guide RNAs (gRNA) as performed for B. α-tubulin represents loading control. (B) MTS cell viability assay in the presence of floxuridine. Error bars, mean ± SEM, n=2 biological replicates. (C) Growth curves in DLD-1 cells upon treatment with 15 μM METTL3 inhibitor and indicated drug concentration post treatment. Error bars, mean ± SEM, n=3 biological replicates. (D) Representative images from DLD-1 UNG KO upon treatment with floxuridine for 66 hours. Prior to staining with N6-methyladenosine antibody, indicated samples were treated with RNase A or DNase. (E) Quantification of experiment represented in D for percentage of cells with >5 N6-methyladenonsine foci. Error bars, mean ± SEM; Repeated measures one-way ANOVA with Dunnet’s multiple comparisons test with a single pooled variance, ∗p ≤ 0.05, n = 5 biological replicates. (F) Ratio of 6mA analyte to dA analyte as detected in DNA of DLD-1 cells upon treatment with 500 nM floxuridine or 500 nM raltitrexed using UPLC-MS/MS. ∗∗∗∗p ≤ 0.0001, n=3 biological replicates. (G) Representative images of 6mA staining in DLD-1 UNG KO cells upon treatment with 500 nM of floxuridine and 30 μM METTL3 inhibitor at 64 hours. (H) Quantification of experiment represented in G for percentage of cells with >10 6mA foci. Error bars, mean ± SEM; Ordinary one-way ANOVA with Dunnett’s multiple comparisons test with a single pooled variance, ∗p ≤ 0.05, n = 3 biological replicates. HPRT, cutting control targeting intronic region of HPRT gene; Flox, floxuridine; METTL3i, METTL3 inhibitor
We next sought to directly observe the deposition of N6-methyladenosine in response to an increase in genomic uracil. The methylation modification itself can be visualized using an antibody that recognizes N6-methyladenosine in single-stranded nucleic acid species, whether RNA or DNA. Pre-extraction of cells prior to fixation allows for the removal of cytoplasmic content, reducing background signal from m6A-modified RNA in the cytoplasm (Figure S3D). Using non-denaturing conditions, which preserve double stranded nucleic acids, we observed minimal N6-methyladenosine signal in untreated cells. Upon treatment with floxuridine, we observed a significant increase of cells displaying a nuclear N6-methyladenosine signal which appeared to be enriched in discrete foci (Figure 3D, E). DNase and RNase treatments prior to staining allowed for discrimination of DNA or RNA as the nucleic acid species that produced the N6-methyladenosine signal. The percentage of cells that displayed floxuridine-induced N6-methyladenosine foci were unchanged in response to treatment with RNase A, which we found surprising given the well-established role for m6A in RNA (Figure 3D, E). Using an agarose gel, we confirmed that the RNase A treatment efficiently removed RNA (Figure 3SE). Treatment with RNase H, which degrades the RNA strand of RNA-DNA duplexes, also failed to reduce the percentage of cells with floxuridine-induced N6-methyladenosine signal (Figure S3F, G). In contrast, upon treatment with DNase, the percentage of cells with floxuridine-induced N6-methyladenosine foci was significantly reduced and became statistically equivalent to untreated conditions, indicating that the observed N6-methyladenosine species is a modification of DNA, 6mA. Removal of DAPI signal upon DNase treatment confirmed effective DNA degradation (Figure S3H). These results were confirmed using mass spectrometry to identify 6mA and dA analytes. We observed that upon treatment with floxuridine the ratio of 6mA to dA significantly increased (Figure 3F). Similar results were observed in cells treated with chemotherapeutic agent raltitrexed in place of floxuridine (Figure 3F, Figure S3I, J).
METTL3, together with METTL14, can methylate DNA in purified settings 31–33 and contributes to the trace amounts of 6mA observed at baseline in genomic DNA 34. Thus, we hypothesized that 6mA foci observed in response to floxuridine treatment were deposited by METTL3. Consistent with this hypothesis, METTL3 inhibition upon floxuridine or raltitrexed treatment did not significantly change the percentage of 6mA foci compared to the DMSO control (Figure 3G, H) (Figure S3K, L), demonstrating that 6mA foci linked to uracil incorporation in DNA are partially METTL3-dependent.
6mA promotes uracil repair upstream of UNG2 in uracil base excision repair
Our data show that METTL3-dependent deposition of 6mA is involved in response to chemotherapeutics that introduce uracil-based DNA damage, which is predominantly repaired by UNG-dependent mechanisms. Thus, we sought to determine the molecular relationship between METTL3 and 6mA with UNG2. First, we tested whether METTL3 inhibition could modulate UNG2 foci formation following uracil-based DNA damage. We observed that METTL3 inhibition alone causes an increase in UNG2 foci in untreated conditions (no floxuridine) (Figure 4A, B). This is likely explained by increased expression of UNG2-mCherry as observed by qPCR and western blot (Figure 4C, Figure 4SA), which is consistent with the described dependence of condensate formation on protein concentration 16,19. Since METTL3 can methylate mRNAs to affect their stability, it is possible that METTL3 is altering the stability of the mCherry-UNG2 transcripts in an RNA-dependent mechanism. As described in Figure 1A, treatment with floxuridine alone increased the percentage of cells with UNG2 foci further than that of METTL3 inhibition alone (Figure 4A, B). Importantly, concomitant treatment with floxuridine and a METTL3 inhibitor significantly reduced the percentage of cells displaying UNG2 foci compared to the floxuridine only conditions (Figure 4A, B). Inversely, we tested whether UNG2 was required to form 6mA foci in response to floxuridine treatment. The percentage of cells that formed 6mA foci in response to floxuridine treatment was unchanged in wild-type and UNG KO DLD-1 cells (Figure 4D, E). These data are consistent with METTL3 and 6mA functioning upstream of UNG2 in repair of uracil-based DNA lesions.

6mA promotes uracil repair upstream of UNG2 in uracil base excision repair.
(A) Representative images of mCherry staining in DLD-1 UNG KO cells expressing UNG2-mCherry cDNAs upon treatment with 500 nM floxuridine and 30 μM METTL3 inhibitor at 64 hours.
(B) Quantification of experiment represented in A for percentage of cells with >5 mCherry foci.
Error bars, mean ± SEM; Ordinary one-way ANOVA with Tukey’s multiple comparisons test with a single pooled variance, ∗p ≤ 0.05, n = 3 biological replicates. (C) Real-time quantitative PCR from A, B for UNG2 transcript levels normalized to tubulin controls. Error bars, mean ± SEM; Mann-Whitney t-test for the following pairs: DMSO versus METTL3 inhibitor and floxuridine versus floxuridine + METTL3 inhibitor. ∗p ≤ 0.05, n = 3 biological replicates except for the floxuridine only condition which includes n=2 biological replicates. (D) Representative images of 6mA staining in DLD-1 UNG KO cells upon treatment with 500 nM floxuridine at 64 hours. HPRT indicates wild type cells. These cells were targeted with a cutting control targeting the intronic region of HPRT gene. (E) Quantification of experiment represented in D for percentage of cells with >5 6mA foci. Error bars, mean ± SEM; RM one-way ANOVA with Dunnet’s multiple comparisons test with a single pooled variance, ∗p ≤ 0.05, n = 5 biological replicates.
Flox, floxuridine; METTL3i, METTL3 inhibitor
To understand if 6mA embedded in DNA has a direct effect on modulating UNG loading onto DNA, we examined the binding kinetics of recombinant UNG catalytic domain (amino acids 93-313, present in both UNG isoforms) to 6mA containing DNA templates by biolayer interferometry. We did not observe changes in UNG binding between dsDNA containing 6mA, either when 6mA was base paired with uracil or when 6mA was present two bases away from uracil on the same strand, and ssDNA containing 6mA compared to uracil only containing controls (Figure S4B, C). We cannot exclude the possibility that additional factors in the cell, not present in the purified settings used here, may affect UNG binding to 6mA-containing templates (See Discussion).
6mA promotes genome repair of base damage beyond uracil incorporation
Building on the importance of METTL3-dependent 6mA modification in response to floxuridine treatment, we sought to define whether 6mA’s role in DNA repair is unique to uracil or a general response to DNA damage. To do so, we examined the ability of METTL3 inhibition to sensitize SW620 cells to an expanded panel of DNA damaging agents. We found METTL3 inhibition sensitized cells to HU and gemcitabine, but minimally to MMC (Figure 5A-C). Similarly, the percentage of cells with 6mA foci was significantly increased in response to HU and gemcitabine, but not MMC (Figure 5D, E). To assess whether DNA damage levels were linked to the ability of cells to form 6mA foci, we quantified the mean nuclear γH2AX intensity for each treatment. MMC treatment induced similar γH2AX levels to those produced by treatment with floxuridine or raltitrexed (Figure S5A, B). Thus, the occurrence of 6mA foci does not seem to be a general response to damage, such as the MMC-induced replication stress, but an event linked to base DNA damage. Taken together these data suggest that METTL3 function and 6mA deposition respond to DNA damaging agents that cause base lesions, as induced by floxuridine, raltitrexed, gemcitabine, or HU. This base damage extends beyond that of only uracil-DNA incorporation since gemcitabine does not cause uracil incorporation into the genome and accordingly does not induce UNG2 foci (Figure S2C, D). Further, when cells are co-stained for both mCherry and 6mA, there are cases where UNG2 and 6mA form foci in the same cells and appear to have overlapping signals (Figure S5C). However, there are cases that 6mA forms foci and UNG2 does not (Figure S5C).

6mA promotes genome repair of base damage beyond uracil incorporation.
(A, B, C) MTS cell viability in SW620 cells upon treatment with METTL3 inhibitor and indicated concentrations of drugs. Error bars, mean ± SEM, n=3, technical replicates, representative of 3 biological replicates. (D) Representative images of 6mA staining in DLD-1 UNG KO cells upon treatment with indicated DNA damaging agents at 64 hours. (E) Quantification of experiment represented in D for percentage of cells with >5 6mA foci. Error bars, mean ± SEM; Ordinary one-way ANOVA with Dunnet’s multiple comparisons test with a single pooled variance, ∗∗p ≤ 0.01, n = 3 biological replicates for all except for the HU condition which includes n=2 biological replicates. (F) Schematic of colony formation assay. SW620 cells, maintained in HAT media, were treated with 30 μM of METTL3 inhibitor for 7 days. 0.5×104 METTL3 inhibitor-treated cells seeded in the presence of 5 μM 6-Thioguanine (TG) and colony formation assay was assessed after 14 days. 0.5×102 METTL3 inhibitor-treated cells were seeded for untreated controls. (G) Representative dishes after 14 days of growth in 5 μM TG as described in F. (H) Quantitation of mutation frequency from G. Mutation frequency was calculated by normalizing to the untreated controls. Error bars, mean ± SEM; Paired t-test, ∗∗p ≤ 0.01, n = 3 biological replicates. HU, hydroxyurea; Gem, gemcitabine; MMC, mitomycin C; TG, 6-thioguanine; METTL3i, METTL3 inhibitor
Our data suggest that 6mA embedded in DNA facilitates repair of lesions caused by DNA damaging agents beyond that of uracil. Importantly, 6mA has an established role in MMR in prokaryotes that has not been described for eukaryotes. In Escherichia coli (E. coli), dam methylase labels the parental strand of plasmid DNA with 6mA during replication. This results in hemi-methylated DNA indicating to the DNA repair machinery the parental strand (bearing 6mA modifications) that acts as the template for repair and the daughter strand that needs repairing. Thus, 6mA provides the strand discrimination signal for repair of mismatched bases on the daughter strand in E. coli. To explore whether there exists an evolutionarily conserved function for 6mA in MMR, we examined the relationship between METTL3 and 6mA with MMR in mammalian cells. We performed an MMR assay measuring mutation frequency in SW620 cells, a human MMR-proficient cell line. A deficiency in MMR results in increased mutation frequency, including at the HPRT locus leading to resistance to 6-thioguanine (TG), as previously described 35,36. Upon pre-treatment with a METTL3 inhibitor, SW620 cells were more resistant to TG, reflecting an increase in damaging mutations at the HPRT locus and overall mutational burden (Figure 5I-K). These data suggest that METTL3 promotes MMR-dependent DNA repair in mammalian cells.
Discussion
This study demonstrates that METTL3-dependent 6mA deposition in DNA is functionally relevant to DNA damage repair in mammalian cells. Prior to this study, the role of METTL3 in depositing 6mA in DNA has been elusive and understudied compared to its role in RNA. METTL3 methylates ssDNA or mismatched dsDNA in biochemical experiments 37. Intriguingly, METTL3 methylates DNA with higher efficiency compared to RNA, while the reverse pattern is observed with regards to binding affinity, with METTL3 binding with higher affinity to RNA 31. In cells, METTL3 contributes to low baseline 6mA levels in the genome 34 and 6mA has been proposed to play a role in faithful DNA repair (reviewed in 38). Our data provide evidence in cells that METTL3 deposits 6mA in DNA and, for the first time, we endow 6mA with a function, namely the repair of base lesions. We note that among the many roles of METTL3 and the m6A modification in RNA, such as mRNA splicing, translocation, translation, decay, and stability (reviewed in 15), m6A in RNA also plays a role in DNA repair, including in homologous recombination and nucleotide excision repair 12,39,40. Separate from these described roles of m6A in RNA, here we find DNA-embedded 6mA is biologically relevant and functions in repair of DNA base damage.
We show that METTL3 and 6mA play a key role in maintaining genome stability, specifically by contributing to the repair of base damage, including, but not limited to, uracil incorporation. We observe that METTL3 is upstream of UNG2 in U-BER and contributes to MMR. Our data revealed that METTL3-deposited 6mA promotes UNG2 foci formation in presence of uracil-based damage. This was not a direct effect of 6mA in modulating the binding of UNG catalytic domain to a DNA template. We hypothesize that additional factors present in the cell, but excluded from our purified system, could impact the ability of 6mA to modulate UNG binding. Proteins that bind m6A in RNA, often referred to as “readers,” have various roles that direct the biological function of the modification. While the YTH family of proteins have been implicated to “read” 6mA, readers of 6mA are less studied33,41. It is tempting to speculate that readers known to bind to m6A when embedded in RNA, or hypothetical 6mA readers, might interact with 6mA in DNA and modulate UNG2 loading at sites of damage. While this hypothesis remains to be assessed, EIF3A and HNRNPC, known m6A RNA readers, scored in the UNG2-IDR condensate proximity biotinylation assay described in Figure 2.
Our study describes a role of the 6mA modification in response to various kinds of base damage, but its role in MMR and additional repair pathways remains to be fully explored. It would be interesting to test whether 6mA can promote strand-specificity of repair for MMR, like it does in E. coli. Additionally, whether 6mA could coordinate the interplay between U-BER and MMR is unknown. This would be particularly relevant in B cell models, where cytosine deamination plays a programmed biological role to produce mature antibodies and relies on error-free or error-prone mechanisms directed by U-BER and MMR (reviewed in 42). We expect our study to provide a foundation for future studies aimed at elucidating the molecular mechanisms by which 6mA coordinates DNA repair responses.
Consistent with the data, our model represents 6mA present in ssDNA, but the details surrounding its specific location within the DNA template and relative proximity to base damage, such as a mismatch or uracil, are unknown. 6mA could reside in gaps in dsDNA that occur because of resection during repair or during normal DNA replication. Understanding how 6mA deposition might be coordinated during DNA replication would be key to the mechanistic underpinnings of its role in repair. Supporting a DNA replication link with 6mA, METTL3 travels with the replication fork 43. It is possible that 6mA is a transient modification during normal DNA replication and only increases above limits of detection upon DNA damage. This is consistent with the observed low baseline 6mA levels in the genome 34. The work presented here enables additional avenues of investigation to explore and further define the role of 6mA in DNA.
The identification of 6mA in the repair of DNA base damage has potential therapeutic implications. It is possible that combining METTL3 inhibition with a base-damaging chemotherapeutic agent would improve the efficacy of chemotherapy alone. Additionally, loss of METTL3 has been shown to enhance response to anti-PD-1 treatment in MMR proficient, low microsatellite instability CRC 44 as well as in lung tumor models 45. Given the relationship between MMR status, microsatellite instability, and cancer immunotherapies, we hypothesize that loss of factors that deposit 6mA may also serve as a potential biomarker for dysregulated MMR. Thus, the discovery presented here of a functional role for 6mA in promoting genome stability represents a significant advancement from both fundamental and clinical perspectives.
Limitations of the Study
As discussed above, we did not see an effect of 6mA embedded in DNA on UNG binding in purified settings. However, the biochemical assay used presents certain limitations. It is possible that UNG recognizes specific placements of 6mA in relation to U, or structural features, such as a forked substrate representing DNA replication, not tested in our binding assay. Our assay would also not be able to detect if other UNG domains, outside of the catalytic domain, alter binding to the 6mA-containing DNA templates.
While we uncovered a role of METTL3 in depositing 6mA in the genome, we did not reveal all the factors and dynamics that control 6mA incorporation in genomic DNA. It is possible other methyltransferase, such as METTL4 and N6AMT1, both of which have been shown to deposit 6mA in DNA, could contribute to 6mA deposition in response to DNA damage or other stimuli 46–50. Moreover, it is also possible that some level of the 6mA modification could be incorporated into the genome by a DNA polymerase, as observed in experiments observing Pol λ-dependent genomic incorporation of supplemented N6-methyldeoxyadenosine in mammalian cells 51. Finally, while we established the importance of the N6-adenonsine methyltransferase, METTL3, we did not explore a potential role for 6mA demethylases, such as ALKBH1 52 or ALKBH4 53,54, and we note that FTO, an RNA m6A demethylase, scored in the UNG2-IDR condensate proximity biotinylation assay (Figure 2). We imagine there would exist a finely tuned balance between methylation and demethylation in regulating 6mA deposition and function.
Acknowledgements
We thank Veronica Jové and Veronique Frattini for thoughtful comments on the manuscript, Pfizer’s Postdoctoral Program for their support. We thank former Pfizer colleagues, Sarah Du, Chunying Zhao, and Alison Varghese for their help with generating reagents. We would also like to thank Pfizer colleagues in Emerging Science and Innovation, especially Paul Wes and Benedikt Bosbach, for stimulating questions, discussions, and technical expertise. This work was supported by Pfizer Inc.
Additional information
Author Contributions
Conceptualization, B.A.C. M.O., and D.S.; Methodology, B.A.C., M.O., J.A. (cell line generation), Q.X. (CRISPR screen), and B.R.S. (proximity biotinylation); Investigation, B.A.C. (CRISPR screen, coimmunoprecipitations, cell viability, immunofluorescence), J.A. (cell line generation), D.T. (CRISPR screen), P.P. (proximity biotinylation), N.D.L.C. (proximity biotinylation), L.N. (cell viability), C.N. (LC-MS/MS for coimmunoprecipitations) and S.V. and T.M. (UPLC-MS/MS for analytes; Analysis, B.A.C (cell viability, immunofluorescence), L.N. (cell viability), Q.X. and L.S. (functional genomics screen), R.T.V. (proximity biotinylation), C.N. (LC-MS/MS for coimmunoprecipitations) and S.V. and T.J.M. (UPLC-MS/MS for analytes. Writing – Original Draft: B.A.C. and M.O. with input from all authors; Visualization, B.A.C.; Supervision, D.S. and M.O.
Declaration of Interests
B.A.C., L.N., D.T., S.V., T.J.M., C.N., P.S., Q.X., L.S., J.A., D.S. and M.O. are or were employees of Pfizer Inc. and may own Pfizer stock. P.P., R.T.V., N.D.L.C., and B.R.S., received research funding from Pfizer Inc. B.R.S. is an advisory board member of Molecular Cell.
STAR Methods Text
Resource availability
Lead contact
Further information and requests for resources and reagents should be directed to and will be fulfilled, whenever possible, by the lead contact.
Materials availability
There may be licensing restrictions to the availability of engineered cell lines and plasmids generated in this study.
Data and code availability
Whole genome sequencing data have been deposited at GEO and are publicly available as of the date of publication. Accession numbers are listed in the key resources table. CellProfilier image analysis pipelines will be shared by the lead contact upon request. The paper does not report additional original code. Any additional information required to reanalyze the data reported in this paper is available from the lead contact upon request.
Experimental model details method details
Cell Lines
SW620, DLD-1 and DLD-1 derived cell lines were maintained in RPMI-1640 + 10% fetal bovine serum (FBS) + 1X Penicillin-Streptomycin. HT-29 and HT-29 derived lines were maintained in McCoy’s 5A + 10% FBS + 1X Penicillin-Streptomycin. U2OS 2-6-3 cells were grown in full DMEM supplemented with 10% FBS, penicillin-streptomycin and GlutaMAX. All cells were maintained at 37 °C with 5% CO2 in a humidified sterile incubator.
Generation of Stable Cell Lines
To establish DLD-1 UNG KO cell lines, 2 x 105 DLD-1 cells were nucleofected with ribonucleoprotein complexes targeting UNG (UNG gRNA_UNG_4) or HPRT (gRNA_HPRT) using the SE Cell Line 4D-Nucleofector X Kit (Lonza) and CM-150 program on the 4D-Nucleofector (Lonza). Ribonucleoprotein complexes consisting of 104 pmol Cas9 (IDT) and 120 pmol trRNA:crRNA (1:1) (IDT), 2.5 μL electroporation enhancer (IDT) were prepared in SE nucleofection buffer (IDT) to a final volume of 25 μL per sample as described in IDT’s Alt-R CRISPR-Cas9 System protocol and transferred to each well of a nucleofector 8-well strip. Following nucleofection, 75 μL of the appropriate pre-warmed culture medium was added to each well of the nucleofector 8-well strip and 50 μL of mixture was transferred to a 96-well plate. 48-72 hours after nucleofection, half of the cells were collected to extract DNA to assay cutting efficiency and the remaining cells were seeded for single-cell cloning. Knockout in clonal lines were confirmed by western blot.
To generate UNG2 cDNA expressing cell lines, cDNAs were delivered by retroviral or lentiviral transduction after packaging in HEK 293T cells. 5×106 were plated the evening before transfection. DNA and viral packaging vectors were transfected into cells with TransIT-293 transfection reagent according to the manufacturer’s protocol. The media was changed the next day and after 24 hours, supernatants were harvested and filtered (0.45 μM). Harvests were repeated every 12 hours for 2 days. Target DLD-1 UNG KO cells were infected with virus-containing supernatants supplemented with 4 μg/mL polybrene. Stably expressing cells were selected with puromycin (0.5–2 μg/ml). See resource for the list of plasmids used.
U2OS 2-6-3 cells were co-transfected with a plasmid expressing the PiggyBac transposase and a PiggyBac donor plasmid containing the doxycycline inducible fusion protein GFP-LacI-APEX2-UNG2_IDR and puromycin resistance. Cells were incubated in Lipofectamine™ 3000 Transfection Reagent for 48 hours and allowed to recover for 24 hours post transfection. Cells were selected by incubating in full DMEM supplemented with 1.5 μg/mL of puromycin for 5-7 days. Selection media was changed every other day. Two stable cell lines were made. One with GFP-LacI-APEX2-UNG2_IDR (LA-UNG2_IDR) stably integrated and a control with GFP-LacI-APEX2-STOP (LA-STOP) stably integrated.
CRISPR/Cas9 Screening
HT-29 cells were transduced with pLenti7-EF1a-Cas9 and cells were selected with 2 mg/ml hygromycin containing medium. Cas9 expression was confirmed by western blot. Cas9 gene editing efficiency was confirmed by next generation sequencing and colony forming assay. Cas9-expressing HT-29 cells were transduced with a lentiviral sgRNA library, split into four pools. Each pool was transduced at a MOI of 0.3 and 1 μg/mL puromycin-containing medium was added the next day. Selection was continued until 4 days post transduction, which was considered the initial time point, t0. At this point the transduced cells were divided into two populations and split into technical triplicates. One population was untreated and 2.2 nM floxuridine was added to the other. Cells were grown with or without floxuridine until t11 or t15, subculturing every three to four days. Cell pellets were frozen at each time point for genomic DNA (gDNA) isolation. A library coverage of ≥500 cells/sgRNA was maintained throughout the screen. gDNA from cell pellets was isolated using QIAGEN Gentra Puregene kit and genome-integrated sgRNA sequences were amplified by PCR using KOD Hot Start Polymerases. i5 and i7 multiplexing barcodes (Ilumina) were added in a second round of PCR and final gel-purified products were sequenced on Illumina HiSeq2500 or NextSeq500 systems to determine sgRNA representation in each sample. Gene knockouts enriched at t11 or t15 as compared to t0 were identified using Model-based Analysis of Genome-wide CRISPR-Cas9 Knockout (MAGeCK) analysis.
Coimmunoprecipitation and Mass Spectrometry
Coimmunoprecipitation: DLD-1 UNG KO and DLD-1 HPRT cells were grown in the absence or presence of 16 nM floxuridine for 72 hours. Cells were collected and lysed in 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1% Triton, 300 mM KCl, 10% glycerol, 1X Halt Protease & Phosphatase Inhibitor, 1 mM Bond-Breaker TCEP Solution and benzonase (IP buffer) for 30 minutes on ice, vortexing every 10 minutes. Debris were pelleted at 15,000 x g for 15 minutes and 40 μL of protein G dynabeads slurry, coupled to 5 μg of the indicated antibody (either UNG or IgG), was added to the supernatant and rotated for 1 hour at 4 °C. Samples were washed in ice-cold IP buffer 3 x 5 minutes each wash. Beads were then eluted with 90 μL of LDS buffer + 1X reducing agent.
Sample processing, data acquisition and analysis: Eluates were subjected to chloroform/methanol protein precipitation for removal of salts and detergents. An aliquot of eluate was first mixed with 4 volumes of methanol, followed by 1 volume of chloroform, and 3 volumes of water. Samples were vortexed vigorously and centrifuged 5 minutes at 14,000 x g. The top aqueous layer was then discarded and 4 volumes of methanol were added before centrifuging for 5 minutes at 14,000 x g. The supernatant was removed, and the remaining protein pellet was dried using a SpeedVac. Protein pellets were dissolved in 100 mM Tris pH 8.0, before reduction and alkylation with dithiothreitol and iodoacetamide, respectively. Proteins were digested with LysC overnight at room temperature and digested with trypsin for 12 hours at 37 °C. Digestion was stopped with the addition of formic acid. Tryptic peptides were desalted with Sep-Pak C-18. LC-MS/MS was performed using a Waters® nanoACQUITY UPLC® System coupled to a Orbitrap Fusion™ Lumos™ Tribrid™ Mass Spectrometer. Peptide separation was carried out with an Easy-Spray 50 cm column prepacked with 2 μm C-18 resin. Mass spectrometric analyses were carried out in positive ESI automatically switching between survey (MS) and fragmentation (MS/MS) modes for the top 10 highest peaks. Both survey and fragmentation spectral scans were acquired in the Orbitrap analyzer, with resolution preset at R = 60,000 and R = 15,000, respectively. The most intense spectral peaks with assigned charge states of ≥ 2 were fragmented by higher energy collision dissociation at a threshold 30 NCE. Isolation window was set at 0.5 m/z while the dynamic exclusion was set at 90 seconds. Automatic Gain Control target was set for 1.2 x 105 ions with a maximum injection time of 100 milliseconds.
Data processing protein identification and quantitation were performed using MaxQuant. Peptide identification was carried out using Andromeda search engine by querying the Uniprot human FASTA. LysC and trypsin were selected as digestion enzymes. Variable modifications were acetyl (protein-N-term), oxidation (M) and deamination (NQ) while Carbamidomethyl (C) was selected as fixed modification. Mass deviation threshold for first search and main searches was 20 ppm, respectively. False Discovery Rate (FDR) was set at 0.05 for both Peptide-Spectrum-Match (PSM) and protein.
Cell Viability
Cells were plated in 96-well plates (Corning, 3585) at 10,000 cells per well and were subjected to a 9-point dose response of floxuridine. Confluence was measured during floxuridine treatment on an Incucyte instrument (Sartorius, Incucyte S3). At endpoint, when untreated wells reached confluence, dishes were removed from the Incucyte and the MTS assay (Abcam, ab197010) was performed for a measure of cell viability. Cells were seeded and treated the same day as nucleofection for MTS assays assessing the nucleofected DLD-1 cells.
Immunofluorescence
Cells were seeded at 5,000 or 10,000 cells per well and subjected to a 60-hour treatment with indicated drugs in a 96-well glass bottom imaging plate. Cells were fixed with 3.7% formaldehyde in PBS and permeabilized with 0.5% Triton-X in PBS. For anti-N6-methyladenonsine staining, prior to fixation, cells were pre-extracted for 5 minutes with a cytoskeletal extraction buffer (25 mM HEPES pH 7.5, 50 mM NaCl, 1 mM EDTA, 3 mM MgCl2, 300 mM Sucrose, 0.5% Trition X) to remove cytoplasmic signal. Cells were blocked for one hour at room temperature in 5% FBS in PBS and stained overnight at 4 °C with 60 μL of indicated antibodies per well. The subsequent day, the primary antibody mixtures were aspirated, and wells were washed with 5% FBS in PBS three times before incubation with secondary antibody for 1 hour at room temperature. After incubation, the secondary antibody mixture was aspirated and cells were washed in PBS three times with DAPI in the second wash. Cells were left in 100 μL PBS and imaged on a CX7 CellNightSight (ThermoFisher). Images were analyzed using CellProfilier using DAPI staining to create cell nucleic masks, and foci were identified using per-nucleus adaptive thresholding. Arbitrary cut-offs of >5 or >10 foci per nucleus were used to quantify nucleic as positive for foci formation depending on experimental variation of intensity in image sets.
Immunoblotting
Cells were harvested and counted upon collection. An equal number of cells were lysed by resuspension in an equal volume of hot 2X NuPAGETM LDS buffer + 1X NuPAGETM sample reducing agent. Samples were either sonicated or passed through a tuberculin needle 10 times.
Subsequently, samples were boiled for 5 minutes at 95 °C. Equal amounts of protein were separated by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) on precast 4–12% Bis-Tris gels or 10% Bis-Tris gels. 10 μL of Chameleon Duo Prestained Protein Ladder was loaded in the first well of the gel. Gels were transferred onto PVDF membrane using an iBlotTM 2 gel transfer device (Invitrogen). Membranes were blocked for 1 hour in Intercept blocking buffer and incubated in primary antibodies for 2 hours at room temperature or overnight at 4 °C. Membranes were washed in PBST (3 x 10 minutes) before being incubated with fluorescently conjugated secondary antibodies for 1 hour at room temperature, membranes were washed again and visualized by the LiCor imaging system (Odyssey® CLx). See supplemental information for the list of antibodies.
PONDR analysis
Human UNG2 protein sequence (MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVP EESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKK HLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAH GLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH KERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFF GCRHFSKTNELLQKSGKKPIDWKEL) was entered into Predictor of Natural Disordered Regions (PONDR) at www.pondr.com and analyzed using the VSL2 predictor.
optoDroplet Cry2 assay
DLD-1 UNG KO cells expressing Cry2 constructs were made according to methods for generation of UNG2 cDNA expressing cell lines. Cells were plated in chamber wells using DMEM media with no phenol red and imaged the following day on a UltraView spinning disk confocal using a 60x oil immersion objective. Cells were exposed to 5 seconds of blue light (488 nm), before capturing mCherry fluorescence (560 nm) and a single Z plane was captured. This was repeated continuously over the course of 5-10 minutes before capturing new fields.
Biotinylation of UNG-IDR interaction partners in cells
SILAC cell culture: U2OS 2-6-3 LA-stop cell line was seeded in 6-well at 30% confluency in DMEM for SILAC supplemented with 50 mg 13C6 L-Arginine-HCl, 50 mg 13C6 L-Lysine-2HCl, 10% dialyzed FBS, penicillin-streptomycin and GlutaMAX. The cells were expanded in SILAC media for five passages and heavy labeling incorporation of 99.5% was verified by proteomic analysis.
APEX2 reaction: U2OS 2-6-3 cells were grown to 80% confluency and incubated with 500 μM biotin-phenol and 1 μg/mL doxycycline in full DMEM for 24 hours. Cells were treated for 1 minute with 1 mM H2O2 to initiate biotinylating reaction and washed three times with Quencher solution (10 mM sodium ascorbate, 5 mM Trolox, 10 mM sodium azide in DPBS). Cells were washed once with PBS, and collected by trypsinization, and pelleted at 500 x g.
Nuclear extract preparation for proteomic samples: ∼5 x 107 U2OS cell pellet was resuspended in 10 mL of CE buffer (20 mM HEPES-KOH pH 7.9, 10 mM KCL, 5 mM MgCl2, 1 mM EDTA, 0.1% NP-40, 10 mM sodium ascorbate, 10 mM sodium azide, 1 mM DTT, and cOmplete protease inhibitor cocktail and incubated on ice for 5 minutes before pelleting at 500 x g for 5 min at 4C. Nuclear pellet was resuspended in 1 mL of NE buffer (20 mM HEPES-KOH pH 7.9, 500 mM NaCl, 1.5 mM MgCl2, 0.2 mM EDTA, 0.5% NP40, 1 mM DTT, and cOmplete protease inhibitor cocktail) and placed on a rotator for 1.5 hours at 4°C. Samples were centrifuged at maximum speed at 4 °C for ∼35 min and supernatant was collected.
SILAC lysate preparation: Protein concentration was measured using Quibit Protein Assay kit and equal concentrations of heavy control lysate was added to experimental light lysate samples for a sample mix test of 20 μL to be analyzed by mass spectrometry for 1:1 heavy:light ratio optimization. The mix test samples were adjusted to reach a 1:1 ratio as needed before final mix and subsequent pulldown.
Biotinylated protein pulldown: Pierce™ Streptavidin Magnetic Beads were washed three times in 1 mL TBST and once in 1 mL NE buffer (20 mM HEPES-KOH pH 7.9, 500 mM NaCl, 1.5 mM MgCl2, 0.2 mM EDTA, 0.5% NP40, 1 mM DTT, and cOmplete protease inhibitor cocktail). DynaMagTM-2 magnetic rack was used to collect beads and resuspended in 110 μL of NE buffer. Pre-washed streptavidin beads were added to fixed 1:1 heavy:light lysate mix and incubated on a rotator overnight at 4 °C. Streptavidin beads were collected, and supernatant was removed. Beads were washed as described (Hung et al. 2016) twice with RIPA lysis buffer (50mM Tris, 150mM NaCl, 0.1% (w/v) SDS, 0.5% (w/v) sodium deoxycholate and 1% (v/v) Triton X-100 in Millipore water, pH 7.5), once with 1M KCl, once with 0.1 M Na2CO3, once with 2 M urea in 10 mM Tris-HCl pH 8.0, twice with RIPA lysis buffer; wash buffers were kept on ice throughout the procedure. Biotinylated proteins were eluted from the beads in 60 μL 3X Laemmli buffer (6X: 0.35 M Tris-HCl pH 6.8, 30% glycerol, 10% SDS, 20% beta-mercaptoethanol, 0.04% bromophenol blue) supplemented with 2 mM biotin for 10 min at 95 °C. Sample were vortexed briefly, placed on ice for 3 minutes, and spun down briefly to bring down condensation. Proteomic samples were submitted the same day.
Quantitative Real Time Polymerase Chain Reaction
Total RNA was extracted from cells post treatment with 60 hours of indicated treatment using RNeasy Plus Universal Kit according to the manufacturer’s specifications. 5 μg of total RNA was reverse transcribed using Applied BiosystemsTM High-Capacity cDNA Reverse Transcription Kit. The relative levels of genes of interest were determined by RT-qPCR using TaqManTM Gene expression kit using 100 ng of cDNA in qPCR reactions. For qPCR reactions, TaqManTM Gene expression Master Mix was prepared with GAPDH or UNG TaqmanTM Assays in triplicate. Reactions were run and analyzed on an Applied BiosystemsTM Quant Studio Flex 7 RT system.
Biolayer Interferometry
Biolayer interferometry binding assay for determination of kinetics and affinity of UNG protein to various single- and double-stranded DNA templates was performed on an Octet Red384 instrument (ForteBio, Inc.). Binding experiments were carried out at 25 °C in binding buffer containing 25 mM Tris pH 7.5, and 10 mM NaCl.
Biotin-tagged DNA templates were captured on streptavidin-coated sensors (ForteBio, 18-5019). The capture step was carried out in binding buffer. The plate shake speed was maintained at 1000 rpm throughout the experiment. After initial baseline equilibration of 120 seconds, streptavidin coated sensors were dipped in 3 μg/ml solution of biotin-tagged DNA template for 180 seconds to achieve capture levels of 0.2 nm. The sensors were dipped in buffer for 120 seconds for collecting baseline signal before they were dipped in 150, 50, or 16.7 nM UNG protein in binding buffer for 300 seconds of association phase. The sensors were then immersed in the binding buffer for measuring 600 seconds of dissociation phase. To account for any nonspecific binding, signal for a sample well containing only binding buffer was used as blank and subtracted from all binding data. Binding curves were globally fit to a 1:1 Langmuir binding model using ForteBio Data Analysis 10.0 software to determine binding affinities, Kd, from the kinetics data.
DNA analyte UPLC mass spectrometry analysis
DLD-1 cells were seeded and treated with DMSO, 500 nM floxuridine, or 500 nM raltitrexed for 72 hours. Cells were washed, collected, and DNA was prepped using Quick-DNA/RNA Miniprep Plus Kit (Zymo Research). 1 μg of each sample was digested with 10 U of DNA degradase plus enzyme mix in 50 μL of 1x reaction buffer for 2 hours at 37 °C. After incubation, samples were diluted with 50uL molecular grade water.
Separations were carried out on a ACQUITY UPLC® M-Class System (Waters) with a nanoEase m/z peptide column (Waters) using a strong wash of 50:50 methonal:water and weak wash of 0.1% formic acid in water. The column temperature was maintained at 45 °C. The mobile phases for the separations were 0.1% formic acid in water (A) and 0.1% formic acid in methanol (B). Initial conditions for the analysis were 98% A and decreased linearly for 6 minutes to 65% at a flow rate of a 6.5 μL auth/min. All analytes eluted during this time. Samples were maintained at 10 °C in the autosampler. Overall analysis time was 10.5 minutes which includes a wash step and column re-equilibration. The eluant was analyzed on a Triple QuadTM 7500 (Sciex) mass spectrometer. Due to the significant differences between the levels of analytes, separate analyses were performed for m6A versus dA. For additional mass spectrometry information, please see supplemental information.
Analyte curves were created from stock solutions in water and serially diluted. A trendline was selected to offer the best fit and offer the widest analytical range. IS was added just prior to analysis to a final concentration of 1 nM for dA and 0.05 nM for m6A. For dA analysis, DNA samples were diluted 1:1000 in water prior to analysis and for m6A, the samples were diluted 1:5 in water.
Mutational Frequency Assay
SW620 cells were cultured in HAT containing medium to maintain a functional HPRT locus. Upon seeding cells for treatments with a METTL3 inhibitor, HAT containing medium was replaced with fresh medium. Cells were seeded at 0.5 x 106 cells per flask. Cells were grown for 7 – 9 days in the presence or absence of a METTL3 inhibitor. After METTL3 inhibitor was removed, cells were re-seeded at 5 x 102 or 5 x 104 cells per 10 cm dish in triplicate. Dishes with 5 x 104 cells were treated with 5 μM 6-Thioguanine or medium only control. Cells were grown for 12 – 16 days until visible colonies appeared. Subsequently, media on dishes was aspirated and cells were fixed in 1:1 methanol:crystal violet for 3 minutes at room temperature. Dishes were washed three times with 5 mL PBS. Images of dishes were acquired and the percentage of area containing particles was obtained using ImageJ.
Quantification and statistical analysis
Image quantification was performed with CellProfilier. Statistical analysis was performed using Prism GraphPad. Statistical tests are referenced in figure legends.
Supporting information
Supplemental Table 1. CRISPR screen MAgeCK results, related to Figure 1.
References
- 1.New insights into abasic site repair and toleranceDNA Repair (Amst 90:102866https://doi.org/10.1016/j.dnarep.2020.102866Google Scholar
- 2.DNA mismatch repair-dependent response to fluoropyrimidine-generated damageThe Journal of biological chemistry 280:5516–5526https://doi.org/10.1074/jbc.M412105200Google Scholar
- 3.Inhibition of Human Uracil DNA Glycosylase Sensitizes a Large Fraction of Colorectal Cancer Cells to 5-Fluorodeoxyuridine and Raltitrexed but Not FluorouracilMol Pharmacol 99:412–425https://doi.org/10.1124/molpharm.120.000191Google Scholar
- 4.Base excision repairCold Spring Harbor perspectives in biology 5https://doi.org/10.1101/cshperspect.a012583Google Scholar
- 5.Nuclear and mitochondrial splice forms of human uracil-DNA glycosylase contain a complex nuclear localisation signal and a strong classical mitochondrial localisation signal, respectivelyNucleic Acids Res 26:4611–4617https://doi.org/10.1093/nar/26.20.4611Google Scholar
- 6.5-Fluorouracil Is Efficiently Removed From DNA by the Base Excision and Mismatch Repair SystemsGastroenterology 133:1858–1868https://doi.org/10.1053/j.gastro.2007.09.003Google Scholar
- 7.Postreplicative mismatch repairCold Spring Harbor perspectives in biology 5https://doi.org/10.1101/cshperspect.a012633Google Scholar
- 8.Base Excision Repair: Mechanisms and Impact in Biology, Disease, and MedicineInt J Mol Sci 24https://doi.org/10.3390/ijms241814186Google Scholar
- 9.Uracil in DNA--general mutagen, but normal intermediate in acquired immunityDNA Repair (Amst 6:505–516https://doi.org/10.1016/j.dnarep.2006.10.014Google Scholar
- 10.A METTL3–METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylationNature Chemical Biology 10:93–95https://doi.org/10.1038/nchembio.1432Google Scholar
- 11.METTL3 antagonizes 5–FU chemotherapy and confers drug resistance in colorectal carcinomaInt J Oncol 61https://doi.org/10.3892/ijo.2022.5396Google Scholar
- 12.RNA m(6)A methylation regulates the ultraviolet-induced DNA damage responseNature 543:573–576https://doi.org/10.1038/nature21671Google Scholar
- 13.VIRMA mediates preferential m6A mRNA methylation in 3′UTR and near stop codon and associates with alternative polyadenylationCell Discovery 4https://doi.org/10.1038/s41421-018-0019-0Google Scholar
- 14.METTL3 Is Associated With the Malignancy of Esophageal Squamous Cell Carcinoma and Serves as a Potential Immunotherapy BiomarkerFrontiers in oncology 12https://doi.org/10.3389/fonc.2022.824190Google Scholar
- 15.The role of m6A modification in the biological functions and diseasesSignal transduction and targeted therapy 6https://doi.org/10.1038/s41392-020-00450-xGoogle Scholar
- 16.Biomolecular condensates: new opportunities for drug discovery and RNA therapeuticsTrends in Pharmacological Sciences 43:820–837https://doi.org/10.1016/j.tips.2022.07.001Google Scholar
- 17.Biomolecular condensates: organizers of cellular biochemistryNature reviews. Molecular cell biology 18:285–298https://doi.org/10.1038/nrm.2017.7Google Scholar
- 18.Liquid phase condensation in cell physiology and disease. Science (New YorkN.Y 357https://doi.org/10.1126/science.aaf4382Google Scholar
- 19.Biomolecular Condensates in the NucleusTrends Biochem Sci 45:961–977https://doi.org/10.1016/j.tibs.2020.06.007Google Scholar
- 20.Uracil DNA N-Glycosylase Promotes Assembly of Human Centromere Protein APloS one 6:e17151https://doi.org/10.1371/journal.pone.0017151Google Scholar
- 21.Spatiotemporal Control of Intracellular Phase Transitions Using Light-Activated optoDropletsCell 168:159–171https://doi.org/10.1016/j.cell.2016.11.054Google Scholar
- 22.Functional partitioning of transcriptional regulators by patterned charge blocksCell 186:327–345https://doi.org/10.1016/j.cell.2022.12.013Google Scholar
- 23.Spatially resolved proteomic mapping in living cells with the engineered peroxidase APEX2Nature protocols 11:456–475https://doi.org/10.1038/nprot.2016.018Google Scholar
- 24.Directed evolution of APEX2 for electron microscopy and proximity labelingNature Methods 12:51–54https://doi.org/10.1038/nmeth.3179Google Scholar
- 25.Cell cycle-specific UNG2 phosphorylations regulate protein turnover, activity and association with RPAThe EMBO journal 27:51–61https://doi.org/10.1038/sj.emboj.7601958Google Scholar
- 26.RPA2 winged-helix domain facilitates UNG-mediated removal of uracil from ssDNA; implications for repair of mutagenic uracil at the replication forkNucleic Acids Res 49:3948–3966https://doi.org/10.1093/nar/gkab195Google Scholar
- 27.The UNG2 Arg88Cys variant abrogates RPA-mediated recruitment of UNG2 to single-stranded DNADNA Repair (Amst 11:559–569https://doi.org/10.1016/j.dnarep.2012.03.006Google Scholar
- 28.Dynamic assembly of the mRNA m6A methyltransferase complex is regulated by METTL3 phase separationPLOS Biology 20:e3001535https://doi.org/10.1371/journal.pbio.3001535Google Scholar
- 29.m(6) A deposition is regulated by PRMT1-mediated arginine methylation of METTL14 in its disordered C-terminal regionThe EMBO journal 40:e106309https://doi.org/10.15252/embj.2020106309Google Scholar
- 30.Small-molecule inhibition of METTL3 as a strategy against myeloid leukaemiaNature 593:597–601https://doi.org/10.1038/s41586-021-03536-wGoogle Scholar
- 31.RNA binding to human METTL3-METTL14 restricts N(6)-deoxyadenosine methylation of DNA in vitroeLife 11https://doi.org/10.7554/eLife.67150Google Scholar
- 32.Human MettL3–MettL14 complex is a sequence-specific DNA adenine methyltransferase active on single-strand and unpaired DNA in vitroCell Discovery 5https://doi.org/10.1038/s41421-019-0136-4Google Scholar
- 33.Human MettL3-MettL14 RNA adenine methyltransferase complex is active on double-stranded DNA containing lesionsNucleic Acids Res https://doi.org/10.1093/nar/gkab460Google Scholar
- 34.High-precision mapping reveals rare N6-deoxyadenosine methylation in the mammalian genomeCell Discovery 8https://doi.org/10.1038/s41421-022-00484-1Google Scholar
- 35.Mutagenesis Studies in Diploid Human Cells with Different DNA-Repair CapacitiesIn: New York, NY, 1981// New York: Springer pp. 264–276Google Scholar
- 36.Resistance to 6-thioguanine in mismatch repair-deficient human cancer cell lines correlates with an increase in induced mutations at the HPRT locusCarcinogenesis 19:1931–1937https://doi.org/10.1093/carcin/19.11.1931Google Scholar
- 37.Human MettL3-MettL14 RNA adenine methyltransferase complex is active on double-stranded DNA containing lesionsNucleic Acids Res 49:11629–11642https://doi.org/10.1093/nar/gkab460Google Scholar
- 38.A Role for N6-Methyladenine in DNA Damage RepairTrends in Biochemical Sciences 46:175–183https://doi.org/10.1016/j.tibs.2020.09.007Google Scholar
- 39.METTL3 and N6-Methyladenosine Promote Homologous Recombination-Mediated Repair of DSBs by Modulating DNA-RNA Hybrid AccumulationMolecular cell 79:425–442https://doi.org/10.1016/j.molcel.2020.06.017Google Scholar
- 40.YTHDF2 promotes DNA damage repair by positively regulating the histone methyltransferase SETDB1 in spermatogoniaBiology of reproduction https://doi.org/10.1093/biolre/ioad136Google Scholar
- 41.Biochemical and structural basis for YTH domain of human YTHDC1 binding to methylated adenine in DNANucleic Acids Res 48:10329–10341https://doi.org/10.1093/nar/gkaa604Google Scholar
- 42.Chapter Two - Molecular Mechanisms of Somatic Hypermutation and Class Switch RecombinationIn: Advances in immunology Academic Press pp. 37–87https://doi.org/10.1016/bs.ai.2016.11.002Google Scholar
- 43.Functional Analysis of the Replication Fork Proteome Identifies BET Proteins as PCNA RegulatorsCell reports 28:3497–3509https://doi.org/10.1016/j.celrep.2019.08.051Google Scholar
- 44.m(6) A RNA methyltransferases METTL3/14 regulate immune responses to anti-PD-1 therapyThe EMBO journal 39:e104514https://doi.org/10.15252/embj.2020104514Google Scholar
- 45.Targeting METTL3 reprograms the tumor microenvironment to improve cancer immunotherapyCell Chemical Biology https://doi.org/10.1016/j.chembiol.2023.09.001Google Scholar
- 46.METTL4-mediated nuclear N6-deoxyadenosine methylation promotes metastasis through activating multiple metastasis-inducing targetsGenome biology 23https://doi.org/10.1186/s13059-022-02819-3Google Scholar
- 47.An Adversarial DNA N6-Methyladenine-Sensor Network Preserves Polycomb SilencingMolecular cell 74:1138–1147https://doi.org/10.1016/j.molcel.2019.03.018Google Scholar
- 48.DNA N6-Methyladenine (6mA) Modification Regulates Drug Resistance in Triple Negative Breast CancerFrontiers in oncology 10https://doi.org/10.3389/fonc.2020.616098Google Scholar
- 49.N(6)-Methyladenine DNA Modification in the Human GenomeMolecular cell 71:306–318https://doi.org/10.1016/j.molcel.2018.06.015Google Scholar
- 50.Reducing N6AMT1-mediated 6mA DNA modification promotes breast tumor progression via transcriptional repressing cell cycle inhibitorsCell death & disease 13https://doi.org/10.1038/s41419-022-04661-8Google Scholar
- 51.N6-methyladenine is incorporated into mammalian genome by DNA polymeraseCell Research 31:94–97https://doi.org/10.1038/s41422-020-0317-6Google Scholar
- 52.The N(6)-methyladenine DNA demethylase ALKBH1 promotes gastric carcinogenesis by disrupting NRF1 binding capacityCell reports 42https://doi.org/10.1016/j.celrep.2023.112279Google Scholar
- 53.An Adversarial DNA N(6)-Methyladenine-Sensor Network Preserves Polycomb SilencingMolecular cell 74:1138–1147https://doi.org/10.1016/j.molcel.2019.03.018Google Scholar
- 54.Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNACell Research 30:197–210https://doi.org/10.1038/s41422-019-0237-5Google Scholar
Article and author information
Author information
Version history
- Preprint posted:
- Sent for peer review:
- Reviewed Preprint version 1:
- Reviewed Preprint version 2:
- Version of Record published:
Cite all versions
You can cite all versions using the DOI https://doi.org/10.7554/eLife.101626. This DOI represents all versions, and will always resolve to the latest one.
Copyright
© 2024, Conti et al.
This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.
Metrics
- views
- 3,127
- downloads
- 223
- citations
- 7
Views, downloads and citations are aggregated across all versions of this paper published by eLife.