Abstract
The unfolded protein response (UPR) is a crucial signaling network that preserves endoplasmic reticulum (ER) homeostasis, impacting both health and disease. When ER stress occurs, often due to an accumulation of unfolded proteins in the ER lumen, the UPR initiates a broad cellular program to counteract cytotoxic effects. Inositol-requiring enzyme 1 (IRE1), a conserved ER-bound protein, is a key sensor of ER stress and activator of the UPR. While biochemical studies confirm IRE1’s role in recognizing unfolded polypeptides, high-resolution structures showing direct interactions remain elusive. Consequently, the precise structural mechanism by which IRE1 senses unfolded proteins is debated. In this study, we employed advanced molecular modeling and extensive atomistic molecular dynamics simulations to clarify how IRE1 detects unfolded proteins. Our results demonstrate that IRE1’s luminal domain directly interacts with unfolded peptides and reveal how these interactions can stabilize higher-order oligomers. We provide a detailed molecular characterization of unfolded peptide binding, identifying two distinct binding pockets at the dimer’s center, separate from its central groove. Furthermore, we present high-resolution structures illustrating how BiP associates with IRE1’s oligomeric interface, thus preventing the formation of larger complexes. Our structural model reconciles seemingly contradictory experimental findings, offering a unified perspective on the diverse sensing models proposed. Ultimately, we elucidate the structural dynamics of unfolded protein sensing by IRE1, providing key insights into the initial activation of the UPR.
Introduction
The endoplasmic reticulum (ER) is central for protein folding, maturation, and delivery of membrane and secreted proteins in eukaryotic cells. 1 The lumen of the ER presents unique features, such as high calcium ion concentration, 2 oxidizing redox potential,3 and a high number of chaperones.4 These unique features must be preserved to ensure correct protein production. Loss of ER homeostasis can lead to the accumulation of unfolded and misfolded proteins, a phenomenon known as ER stress.
The Unfolded Protein Response (UPR) 5 is a collection of signaling pathways that allows eukaryotic cells to counteract ER stress. The membrane protein inositol-requiring enzyme 1 (IRE1) is UPR’s central transducer in all eukaryotes and the most evolutionarily conserved branch of the UPR.6,7 It activates its signaling pathway by forming oligomers and large supra-molecular assemblies. 8–11 IRE1 is a single-pass transmembrane protein and can sense the unfolded protein load of the ER lumen through its core luminal domain (cLD).12–14 Accumulation of unfolded proteins in the ER promotes the formation of multimeric assemblies, allowing the cytosolic kinase domains to trans-phosphorylate15 and activate the RNAse domains. This, in turn, initiates splicing of XBP1 mRNA, which encodes for a transcription factor, 16,17 leading to the transcription of UPR target genes. In addition, the active RNase initiates mRNA decay.18,19 The UPR aims at restoring ER homeostasis and when stress is not mitigated in a timely manner, the UPR triggers cell death via apoptosis.20 Chronic ER stress has been implicated in various diseases, from diabetes to cancer.21 Thus, maintaining the folding equilibrium in the ER is crucial for the proper functioning and viability of eukaryotic cells.
The cLD initiates IRE1’s activation, yet the mechanism by which it detects the accumulation of misfolded proteins remains debated. Two main models have been proposed, which differ in whether the cLD senses unfolded proteins directly or indirectly.22 In the direct binding model, IRE1’s cLD interacts directly with unfolded proteins, triggering assembly and activation.23 Observations that the crystal structure of the cLD dimer 17 of Saccharomyces cerevisiae (yIre1) presents a groove in the central area that resembles the major histocompatibility complex class I (MHC-I) peptide-binding cleft 12 have led to the hypothesis that IRE1 uses a mechanism for unfolded peptide binding similar to the antigen-presenting protein. Subsequently, the binding of unfolded peptides to the yIre1 cLD was demonstrated in vitro and in cells. 13 According to this hypothesis, the peptides bind to the groove delimited by the two monomers’ helices at the center of the dimer, spanning the dimeric interface. However, the structure of human IRE1 ubiquitous isoform α (hIRE1α) cLD dimer features a narrower cleft than the yeast Ire1 cLD. 24 These observations inspired the hypothesis that the conformation observed in yeast represents an ‘open’ state of the dimer, whereas the crystal structure of human cLD represents a ‘closed’ dimer state that requires opening to accommodate peptides. 14 Recently, evidence of direct binding of unfolded polypeptides to the human IRE1α cLD central groove accumulated,14,25–28 indicating that this domain preferably binds peptides enriched in aromatics, hydrophobics, and arginine residues. Moreover, new experiments showed that the human IRE1 already forms dimers in non-stress conditions,29 suggesting that peptides might bind preexisting dimers and induce oligomerization required for the subsequent activation of the sensor. Despite this evidence, we still lack a clear structural understanding of the direct sensing model and how the binding of unfolded peptides promotes the formation of higher-order assemblies.
In the indirect activation model, BiP, a chaperone of the Hsp70 family in the ER lumen, mediates interactions with unfolded proteins.30,31 In this scenario, BiP binds to IRE1, preventing it from forming dimers and oligomers in the absence of stress. At the onset of ER stress, BiP binds to accumulating unfolded proteins, leaving IRE1 free to self-associate and start the UPR signaling cascade. BiP could bind to IRE1 either via its ATPase domain or substrate-binding domain (SBD). 32 Interaction through the substrate domain would hint at a direct competition between IRE1 and unfolded proteins while binding through the nuclease domain supports an allosteric mechanism.32 Moreover, BiP binds to regions of IRE1, which are disordered and part of the oligomerization interface.25,26
In recent years, the field has been converging towards integrating the direct and indirect binding models, where unfolded proteins and BiP interaction with cLD both regulate IRE1.5 We aimed to integrate evidence about the human IRE1α cLD early activation phase to develop a structural understanding of this protein domain’s sensing mechanism.
Here, we performed multi-microsecond equilibrium atomistic molecular dynamics (MD) simulations to investigate the stability of the human IRE1α cLD dimer, its structural features, and its interaction with unfolded polypeptides and BiP. By integrating the crystal structure with Alphafold Multimer 33,34 prediction, we identified the β-sheet interface as well as hydrophobic side chains orientation as the key elements of a stable dimer. Comparison of the dynamics of yeast and human cLD dimer highlighted differences suggesting alternative stress sensing strategies. Our simulations provided structural evidence that unfolded polypeptides bind directly to the center of the human IRE1α cLD dimer, reinforcing their crucial role in cluster formation during the initial phases of ER stress. Additionally, we provide structural evidence supporting a model in which hIRE1α cLD is bound to BiP at the oligomeric interface, inhibiting cluster formation while allowing dimer formation.
Results
The hIRE1α cLD forms a stable dimer
An accurate determination of proteins’ structural dynamics is crucial to understanding their function. MD simulations use the laws of physics to simulate the movements of atoms in a protein, generating a trajectory, a “movie” showing how its structure changes in time. The trajectory can reveal conformational changes, alternative structural organizations, and their relative stability. MD simulations of multiple molecules can reveal how they interact and whether they form stable assemblies. MD simulations require an initial structural model to start generating a trajectory. The human IRE1α core luminal domain (cLD) structure has been resolved by X-ray crystallography and deposited in the Protein Data Bank as a symmetric homodimer (PDB ID 2HZ624). This structure lacks residues in two disordered regions: DR1 (residues L131-S152) and DR2 (residues P308-N357). We used protein sequence information and modeled these gaps as unstructured loops, obtaining the “PDB model” (Fig. 1A, modeled regions are DR1 in cyan and DR2 in orange). Despite its relatively high resolution of 3.10 Å, the PDB structure shows low percentile scores in the wwPDB (Worldwide Protein Data Bank) 35 validation report for global metrics, including torsion angle outliers (Ramachandran and sidechain) and quality of fit (RSRZ outliers). Notably, the PDB dimeric assembly was derived from the crystal packing of the asymmetric unit of the crystal, which includes only one monomer.

The hIRE1α cLD forms a stable dimer validated by hydrogen-deuterium exchange experimental data.
(A) The PDB model: structural model of hIRE1α cLD dimer as obtained by Zhou et al.24 (PDB ID 2HZ6) with the addition of missing residues, in particular DR1 (cyan) and DR2 (orange). Backbone in cartoon representation, areas of interest highlighted in different colors. (B) The AF model: AlphaFold 2 Multimer prediction of hIRE1α cLD dimer (P29-P369). Representation style as in Fig. 1A. (C) The deuterated fraction obtained from experimental results (dashed line) published by Amin-Wetzel et al. 25 and the fraction computed from MD simulations (solid lines, blue for TIP3P water and orange for TIP4PD water) for the PDB and AF model at time points 0.5 min and 5 min. Below each absolute value plot, we report the discrepancy, which is defined as the difference between the simulated and experimental deuterated fractions. (D) Visualization of the discrepancy values from Fig. 1C onto the molecular structures of the PDB and AF model simulated in TIP4P-D water (TIP3P shown in Fig. 1 Suppl. 2A). Shades of blue indicate that the simulated structure is more flexible and solvent accessible with respect to what was reported from experiments, while red indicates that the simulated structure is more rigid and less solvent accessible than measured experimentally.
We generated an alternative cLD dimer structure using AlphaFold 2 Multimer, 33,36 termed the “AF model” (Fig. 1B). The PDB and AF models were similar, with an RMSD of 3.34 Å (aligned on the β-sheet floor, excluding DR1 and DR2) (Supplementary Fig. 7A). Notable structural features (Fig. 1A-B) include the dimer interface (green), where the two monomers establish contacts through an antiparallel β-sheet interaction that determines the cyclic C2 symmetry of the dimer; the MHC-like groove delimited by αA-helices (blue), and the eight-stranded β-sheet floor. AlphaFold captured these features while revealing slight structural differences: DR1 was partly predicted as a β-hairpin rather than disordered (cyan), and DR2 (orange) featured an α-helix (K349-L361). Additionally, the αB-helices (violet) were shorter in the AF model than in the PDB model. The discrepancies in these regions were intriguing as the disordered regions are difficult to study experimentally and might contain transient secondary structures. At the same time, the αB-helices are involved in the formation of a dimer-dimer interface.14 A comparison between the AlphaFold 2 and AlphaFold 3 predictions provided a very similar hIRE1α cLD dimer model (Supplementary Fig. 7B).
Current all-atom force fields used in MD simulations, like CHARMM,37,38 are mainly designed to reproduce the dynamics of folded and globular proteins.39 They struggle to accurately simulate the structural ensemble of disordered proteins and regions, usually describing structural ensembles that are excessively compact. 40,41 One culprit is the commonly used water model called TIP3P,42 which tends to underestimate London dispersion interactions significantly. 40 We, therefore, chose to perform our MD simulations of the two cLD dimer models using TIP3P and TIP4P-D water models in the CHARMM36m force field. The TIP4P-D water model has been developed to alleviate the pitfalls of currently available force fields in reproducing the correct structural ensemble of disordered proteins and regions and is characterized by increased dispersion interactions and slightly stronger electrostatic interaction to achieve a better balance between water dispersion and electrostatic interactions.40 Using TIP4P-D, we aimed to better sample the disordered regions DR1 and DR2 compared to TIP3P.
During our 2 µs-long simulations, the AF and PDB models of the dimer always remained stable, even if the PDB model presented some instabilities in one of the central hydrogen bonds (Supplementary Fig 7C-F). An early PDB model with incorrect side chain orientations in residues L116 and Y166 caused the dimer to dissociate in one-third of the replicas (Supplementary Fig. 7G-H). The proximity of these residues to W125 and P108, essential for dimer formation, 24,25 highlights the importance of hydrophobic residues in stabilizing the dimer interface. The final PDB model was stable in simulations in both TIP3P and TIP4P-D water. While modeling missing regions carries inherent risks, it highlighted the critical roles of L116 and Y166 and the value of testing alternative models. The AF model showed high stability of the dimer interface, and the DR1 fold might contribute to this stabilization. Consequently, we modified the AF model by substituting DR1 with an unfolded loop (Supplementary Fig. 7I). We observed no differences in the stability of the dimer interface, concluding that the DR1 β-hairpin fold does not contribute to dimer stability. In summary, we modeled the human IRE1α cLD dimer by complementing the crystal structure with disordered regions and utilizing structure prediction for an alternative model. Our simulations showed that the dimers remained consistently stable, agreeing with recent experimental results suggesting the IRE1α might constitutively be in a dimer organization even in the absence of stress.29
Hydrogen-deuterium exchange experimental data validate the cLD dimer structure
The two models of human IRE1α cLD dimer exhibited structural differences in certain regions, showing variations in secondary structures and flexibilities. Furthermore, the two distinct water models used, TIP3P and TIP4PD, led to differences in flexibility observed for the same structural model. Therefore, we aimed to validate our models by comparing them with experimental data. In the study by Amin-Wetzel et al., 25 the authors published the results of HDX-MS (hydrogen(1H)-deuterium(2H) exchange mass spectrometry) experiments on the human IRE1α luminal domain. In HDX-MS experiments, a protein is incubated in a deuterated buffer, permitting the amide 1H from the protein backbone to exchange with 2H from the solution. 43 The exchange rate is influenced by the exposure of the backbone hydrogen to the aqueous environment, determined by the amino acid sequence’s chemical nature, the protein’s folded state, and its dynamic rearrangements and flexibility. A hydrogen atom in a folded region of the protein will be less likely to exchange than one in an unstructured region. After incubating the protein in solution for a designated period, it is enzymatically digested, and the deuterium uptake of each fragment is assessed through mass spectrometry. These experiments provide insights into the flexibility and solvent accessibility of the protein regions. Specifically, the measured deuterated fraction of a peptide correlates with the flexibility of the corresponding protein region and is inversely related to its folded structure. From our simulations, we calculated the theoretical deuterated fraction using the method by Bradshaw et al.44 and compared it to the experimental data (Fig. 1C-D and Supplementary Fig. 8A-D). By juxtaposing the experimental data with the results from our PDB and AF models, we can confirm the accuracy of each model.
Both structural dimer models agree well with the HDX-MS data (Fig. 1C), even though only a mixture of the two models could recapitulate the experimental data entirely (Fig. 1D and Supplementary Fig. 8A). The prediction of the deuterated fraction for DR1 based on the PDB model aligns most closely with experimental data. This suggests that DR1 is disordered, contrary to the folding predictions made by the AF model. The dimeric interface was most accurately represented by the AF model, suggesting that the stable dimeric conformation could be constitutive under experimental conditions. The dimeric interface of the PDB model had a predicted deuterated fraction higher than the experimental one, indicating a region that is more water-accessible and flexible than expected. This corresponds to the instability of one H-bond observed in simulations and mentioned earlier (Supplementary Fig. 7E-F), likely due to a suboptimal interface in the dimer of Zhou et al.24 On the other hand, the AF model has a better-formed interface due to optimization by AlphaFold, and the hydrogen bonds were stable throughout all simulations. The αB-helices (V245-I263) are long α-helices found in the crystal structure of human IRE1α cLD that are not found in the yeast homolog structure.12,24 This helical structure may inhibit oligomer formation, as suggested by Zhou et al., 24 and a structural rearrangement might be necessary for oligomerization, as supported by Nuclear Magnetic Resonance (NMR) spectroscopy experiments. 14 In the PDB model, these long helices showed a predicted deuterated fraction lower than the experimental value. This result indicates that the region is slightly more structured and less flexible during simulations than expected. This may be because contacts within the crystal stabilize longer αB-helices compared to what is found in solution. Conversely, the αB-helices are more unfolded in the AF model, and our analysis suggested that this structure aligned better with the experimental data. This supports the idea that the αB-helices could be shorter than what was found in the crystal, and this would allow the structural arrangements observed by the NMR experiments. 14
Overall, different protein regions are best represented by different protein models (Supplementary Fig. 8B-D). However, the AF model has the most stable dimeric interface, and in TIP4P-D water, it produces the highest number of deuterated fractions closer to the experimental ones (Supplementary Fig. 8B-C). Therefore, we chose to use the AF model of the dimer for all our subsequent simulations.
The putative groove of human IREα cLD is dynamic but unable to contain peptides
The fact that the Ire1 cLD dimer closely resembles the peptide-binding groove in the MHC-I, in which peptides nestle into a central cleft, suggested a model for interactions of unfolded proteins and Ire1 in Saccharomyces cerevisiae. However, Zhou et al. 24 argued that the human conformation of the dimer has a groove that is too narrow to accommodate peptides. Indeed, the groove width varies significantly between the two structures in the Protein Data Bank: the groove width is 6.8 Å in hIRE1α and 10.7 Å in yIre1 (yIre1 cLD: PDB ID 2BE112). (Fig. 2A-C and Supplementary Fig. 9A). In our equilibrium simulations, the PDB model of the hIRE1α cLD dimer exhibited a less stable dimeric interface. Consequently, we compared the yeast dimer with the AF model of the human dimer, which features a groove width similar to that of the PDB model, measuring 7.4 Å. During simulations of the dimeric structures, the average groove width was 7.3 ± 0.1 Å for the human cLD and 8.9 ± 0.1 Å for the yeast cLD (average accounting for TIP3P and TIP4P-D replicas). In both humans and yeast, we noted a fluctuating groove width, which was somewhat wider in yeast. Nonetheless, we were unable to differentiate between the open and closed conformations in either structure. These data suggest, in contrast to what has been proposed before, that human IRE1α cLD in isolation does not adopt an open conformation. 14,45

The human IRE1α cLD dimer has a narrower and more occluded central groove than its yeast homolog in equilibrium MD simulations.
(A) Top panel: structure of human IRE1α (hIRE1α) cLD dimer (AlphaFold model). Bottom panel: structure of the S. Cerevisiae IRE1 (yIre1) cLD dimer (PDB ID 2BE1). (B) Close-up on hIRE1α (top panel) and yIre1 (bottom panel) structures on the central groove delimited by the αA-helices. Helices delimiting the groove are depicted in blue cartoon and side chains in licorice representation, while the rest of the dimer is transparent. The arrows indicate the distance between Cα atoms used to compute the groove width. (C) Probability density distribution of the groove width of: hIRE1α cLD dimer computed between Cα of Q105 during simulations in TIP3P and TIP4P-D water (top panel); yIre1 luminal domain dimer computed between Cα of S200 during simulations in TIP3P and TIP4P-D water (bottom panel). Dashed lines indicate the groove width of the dimer model prior to energy minimization.
Despite the structural similarities in the central regions of human and yeast cLD (Fig. 2A), a closer examination reveals differences in the side chains of the αA-helices. In yeast, these are serines (S200), while in humans, they are glutamines (Q105) (Fig. 2B). The glutamines in human cLD possess a longer side chain than serines. The configurations they adopt during simulations enable them to occupy the space between the αA-helices (Supplementary Fig. 9B). These side chain arrangements result in spatial occupancy of the groove, particularly in instances of narrow groove width observed here.
In conclusion, our simulations revealed that in contrast to the yeast cLD that features a wider groove, the putative central groove of human IRE1α cLD is predominantly narrow and occluded by the steric obstruction from neighboring side chains. As our MD simulations did not show large conformational changes leading to the opening of the groove, our data suggest that it is unlikely that peptides bind into the central part of the MHC-like groove in the human IRE1α cLD.
Unfolded polypeptides can stably bind to hIRE1α cLD dimer
Despite its structural diversity compared to MHC-like cleft, hIRE1α cLD can directly bind to polypeptides in vitro.14,26 Therefore, we aimed to investigate the characteristics of peptides in complex with the hIRE1α cLD dimer model through MD simulations. Our goal was to elucidate a potential binding pose and identify the relevant features of unfolded proteins and the cLD that influence binding affinity. The simulated complexes were initialized by positioning the peptides in a fully stretched conformation above the central region of the dimer (Fig. 3A-C, at t = 0 µs). This enabled the peptides to equilibrate near the surface of hIRE1α within a few nanoseconds. In early simulations, we positioned the polypeptides over the cLD, aligning them parallel to the principal axis of the central groove in accordance with the proposed binding mode. We observed that the peptides could rearrange into an ori-entation perpendicular to the central groove axis (Fig. 3A and Supplementary Fig.10A, valine8 TIP4P-D). Conversely, peptides that were initially oriented perpendicularly did not transition to a parallel conformation. This finding suggests that the perpendicular binding mode is preferred. Therefore, we adopted this orientation as the baseline for subsequent simulations.

Unfolded peptides can bind with specificity to the center of the cLD dimer, even if the groove is closed.
(A) AF model of the cLD dimer (gray cartoon) simulated with the unfolded peptide MPZ1-N (violet) positioned parallel to the principal axis of the central groove (t = 0 µs). During the simulation, MPZ1-N rearranges to a vertical position (t = 1 µs). The direction of the principal axis of the central groove is represented by a solid arrow, while the direction of the principal axis of the peptide is indicated by a dashed arrow. (B) AF model of the cLD dimer simulated with unfolded peptide MPZ1N-2X (orange), which stably binds to the center of the dimer. (C) AF model of the cLD dimer simulated with unfolded peptide MPZ1N-2X-RD (red), which unbinds in half of the replicas. (D) Box plot distributions of the minimum groove-peptide distance. Each box plot reports on the results from 3 replicas (in TIP3P or in TIP4PD) of a system containing a dimer and one of the unfolded peptides.
We tested the stability of cLD complexes with polypeptides characterized through fluorescence anisotropy experiments14,26,46 (Fig. 3B-D and Supplementary Fig. 10A-B).
These peptides were primarily derived from Myelin Protein Zero (MPZ) and displayed a range of binding affinities (K1/2; Supplementary Fig. 10C). The most potent binders, MPZ1-N, MPZ1N-2X, and 8ab1, remained bound to the dimer throughout all the 1 µs-long simulation replicas in TIP3P and TIP4P-D water. In contrast, we observed partial dissociation of MPZ1-C, which is a weaker binder. All PERK-targeted peptides, namely OR-1, V1rb2-1, and V1rb2-2, demonstrated strong binding to the cLD dimer. The apolar peptide valine8 dissociated in one-third of the simulations. By mutating all the arginines in MPZ1N-2X to aspartic acid, we obtained the MPZ1N-2X-RD. The MPZ1N-2X-RD has six negative charges instead of the six positive charges present on MPZ1N-2X. These mutations led to the dissociation of MPZ1N-2X-RD in half of the simulations, recovering the impaired binding observed in experiments. We also predicted the cLD dimer with MPZ1N-2X using AlphaFold3. The resulting conformations were similar to those obtained in our MD simulation (Supplementary Fig. 10D), thereby validating our model further. Notably, none of the peptides caused meaningful structural changes in the dimer, and we did not observe a groove opening induced by the peptides (Supplementary Fig. 10E). However, the unfolded peptides, particularly those rich in positively charged residues, remained bound to the hIRE1α cLD dimer surface and were preferentially oriented perpendicular to the groove’s main axis. The simulations generally aligned with the experimental results, establishing a reliable framework for analyzing key binding sites.
Point mutation Y161R destabilizes unfolded peptide binding to cLD
The results from polypeptides-cLD simulations indicated that the cLD of hIRE1α formed selective interactions with the peptides. To investigate the characteristics of this association, we analyzed the contacts established during the simulations. The peptides interacted with various regions on the surface of the cLD dimer, particularly around the central groove (Fig. 4A and Supplementary Fig. 11A). Notably, the region above the αA-helices played a prominent role in these interactions, primarily due to the presence of a negatively charged residue E102, which might influence selectivity for positively charged peptides. However, the contact analysis primarily reflects the spatial proximity of residues and does not provide information regarding chemical specificity or established bonds. Consequently, these findings offer preliminary insights that necessitate further validation through individual trajectory examinations. Detailed observations of the simulation movies indicated that peptides with longer side chains, like arginine, penetrated more into the central region of the dimer. These residues engaged in particular with Y161, D181, and D79, thus forming what we refer to as a polar-charged pocket (Fig. 4B, highlighted in yellow). In contrast, a hydrophobic-aromatic pocket defined by Y117, L103, and F98 (Fig. 4B, highlighted in red) showed affinity for residues like tryptophan, tyrosine, and leucine. The tyrosines Y117 and Y161 were centrally positioned within the two pockets.

Single point mutation of cLD alters the binding affinity of unfolded peptide.
(A) Analysis of contacts between unfolded peptide and cLD dimer for all MD simulations performed in TIP4P-D water. The contact score reported on the AlphaFold model of the cLD dimer was obtained by computing the contacts from all the simulations, summing them, and normalizing them by the number of frames. Lower values indicate fewer contacts observed. (B) Important areas for peptide binding on the surface of the cLD dimer: the red area identifies a hydrophobic-aromatic binding pocket characterized by residues Y117, F98, and L103; the yellow area identifies a deeper polar-charged binding pocket and is characterized by residues Y161, D181, D79. (C) Side view snapshot after 1 µs of simulation of wild-type hIRE1α cLD dimer (gray) in complex with MPZ1N-2X (orange). Amino acid Y161 on both monomers is represented in green licorice. (D) Time series of the minimum groove-peptide distance for MPZ1N-2X simulated in complex with wild-type hIRE1α cLD dimer in TIP3P (3 replicas) and TIP4P-D (3 replicas) water. (E) Side view snapshot after 1 µs of simulation of Y161R hIRE1α cLD dimer (gray) in complex with MPZ1N-2X (orange). Amino acid R161 on both monomers is represented in blue licorice.(F) Time series of the minimum groove-peptide distance for MPZ1N-2X simulated in complex with Y161R hIRE1α cLD dimer in TIP3P (3 replicas) and TIP4P-D (3 replicas) water.
In our analysis, we observe that Y161 interacts with arginines, which are key characteristic residues of peptides with a high affinity for cLD. Arginines and tyrosines can form hydrogen bonds.47 Moreover, the mutation of corresponding residue F285 to alanine impairs the activity of yIre1.12 Therefore, we considered Y161 an interesting binding hotspot and we performed a point mutation to arginine to disrupt as much as possible the biochemical characteristics of this binding site.
We investigated how the point mutation Y161R would affect peptide binding by simulating the cLD mutant in complex with MPZ1N-2X (Fig. 4C-F). We initialized the system in the pose described for the other peptide-cLD systems described earlier (Fig. 3B, t = 0 µs and Fig. 4C-D). In the case of the wild-type (WT) cLD dimer, the peptide generally maintained proximity to the center (Fig. 4E). Conversely, MPZ1N-2X exhibited reduced stability in binding to the Y161R dimer’s surface, with one partial dissociation observed over six replicas, each lasting 1 µs (Fig. 4F). A comparative analysis of the contact sites of MPZ1N-2X on the cLD dimer in both WT and Y161R (Supplementary Fig. 11B-C) demonstrated that, in the presence of the mutation, the peptide interacts with a broader region of the dimer’s surface rather than remaining stably localized at the center.
In summary, the Y161R mutation of cLD destabilized the binding of MPZ1N-2X by lowering the interactions at the center of the hIRE1α cLD dimer.
hIRE1α cLD intermolecular interactions guide the activation process
Throughout the activation process, the hIRE1α cLD forms multiple intermolecular interactions, engaging not only with unfolded proteins but also with other cLDs and BiP. Karagöz et al. proposed a direct activation model whereby unfolded proteins facilitate IRE1 clustering by simultaneously engaging multiple dimers.23 Here, we examined whether our understanding of cLD-unfolded polypeptide interactions would be consistent with this model. We conducted simulations of a system with two cLD dimers bridged by one copy of MPZ1N-2X (Fig. 5A). The complex was established following the same principles as for the single dimer, and the initial configuration was optimized to position the peptide residues near critical residues identified in the contact site analysis, particularly Y161. Throughout the 200 ns of simulation, the two dimers were stably bridged by the peptide. This simulation offers a structural model for the role of unfolded proteins during the initial phase of cluster formation, where it promotes the accumulation of hIRE1α.

hIRE1α cLD intermolecular interactions.
(A) Model of two cLD dimers interacting via an unfolded peptide (MPZ1N-2X): the system setup is shown (t = 0 ns) and a snapshot of the simulation (t = 200 ns). (B) BiP-cLD monomer complex as predicted by AlphaFold (BiP in shades of purple, cLD in orange). In the initial model, before the simulation (t = 0 ns), the interface (inset) is constituted by DR2 and SBD, while at the end of the simulation (t = 460 ns), the N-term of BiP rearranges to form a helix and comes in contact with the αB-helix. The two proteins are represented as cartoons, and the side chains of the interface residues at the end of the simulation are shown as sticks. The SBD (residues M1-D408) is colored in dark magenta and the NDB (residues C420-E650) in purple, and the interdomain linker (residues D409-V419) and KDEL motif (residues K651-L654) in light purple.
We used AlphaFold 2 Multimer to investigate the interaction between cLD and a BiP cLD monomer (Fig. 5B). The predicted interface included DR2, specifically residues 314-PLLEG-318, which formed a small parallel β-sheet interaction via two hydrogen bonds to the substrate-binding domain (SBD) of BiP. The interface predicted by AlphaFold showed stability across MD simulation replicas lasting 200 ns. Furthermore, we leveraged the re-lease of AlphaFold 3 to integrate the natural ligands of BiP: ATP and ADP. The predicted structures for the nucleotide-bound forms (Supplementary Fig. 12A-B) were similar to those obtained with AlphaFold 2. In contrast, the predicted apo complex (Supplementary Fig. 12C) stood apart, as it was the only configuration where the SBD exhibited a closed conformation, with the SBD lid (the helical domain segment of SBD) closing over DR2. Notably, the quality of the predicted complexes for both the apo state and the ATP-bound state were subpar (pTM=0.43, ipTM=0.46 and pTM=0.53, ipTM=0.48, respectively; ideally, pTM > 0.5 and ipTM > 0.6), while prediction quality improved significantly with ADP bound (pTM=0.67, ipTM=0.65). All the AlphaFold 3 structures remained stable for over 500 ns (Supplementary Fig. 12D-F). In many predictions, the αB-helices were located at the complex interface or established interactions with the NBD. The conformations of the cLD-BiP heterodimer predicted by AlphaFold offer a structural hypothesis on how BiP may engage with hIRE1α cLD by imposing considerable spatial hindrance on the suggested oligomeric interface represented by DR2 and the αB-helices.14
Discussion
IRE1 is the most conserved activator of the UPR across all eukaryotes. 6,7 It responds to unfolded protein accumulation in the ER. Understanding the early activation stages of human IRE1α presents significant challenges due to conflicting evidence regarding the mechanism of IRE1’s interaction with unfolded peptides. 14,25 To clarify these early activation stages, we conducted extensive atomistic MD simulations of the human IRE1α cLD and its interaction partners.
Our simulations revealed that the human IRE1α cLD forms stable dimers in solution under conditions similar to in vitro experiments and non-stress situations. Our findings on dimer stability support the recent observation that IRE1 is present in cells as a constitutive homodimer29 that forms oligomers in case of ER stress. We utilized two distinct models of the cLD dimer: one derived from X-ray crystallography 24 (the “PDB model”) and the other predicted by AlphaFold 2 Multimer (the “AF model”).33,34 The comparison between the two models was fundamental for identifying key structural elements. During the modeling of the missing disordered regions on the PDB model, we identified Y166 and L116 side chain orientation as crucial for the stability of the dimer. In fact, some mutants in this region that disturb the formation of dimers were previously identified by size exclusion chromatography,24,25 including W125A, which is in contact with the residues we identified. Furthermore, we leveraged available data on HDX-MS experiments25 to confirm that the dimeric interface is stable and observe that the αB-helices might be shorter than what is observed in the crystallographic structure. This is an interesting observation, given that the αB-helices are supposed to form the oligomerization interface of human IRE1α cLD.14 Comparing simulation results to experimental data helped select the optimal dimer model and water force field, which is crucial for accurately reproducing the ensemble of disordered regions.
Credle et al. proposed that in S. cerevisiae, the Ire1 cLD dimer interacts with unfolded proteins through a mechanism similar to the peptide-binding mode of MHC-I, where peptides occupy a central cleft. 12 Our simulations indicate that in comparison to the yeast IRE1 cLD dimer, the structure of the human dimer has a narrower central groove and is also gated by two glutamine side chains. This conformation prevents the formation of an ‘open’ peptide-binding central groove.
We tested several unfolded polypeptides for binding to the human IRE1α cLD dimer and found that peptides enriched in positive and aromatic residues can stably bind to the central part of the dimer, thanks to negative, polar, and aromatic amino acids. However, the binding does not take place inside the central groove. We found that the residues involved in peptide binding belong to the αA-helices, particularly E102, and to two pockets per monomer, characterized by residues Y117 and Y161. Among the most important contacts, we also identified L186, which was the main source of signal in the paramagnetic relaxation enhancement (PRE) experiments performed by spin-labeled peptides. 14 We find that peptides are able to bind to a ‘closed’ groove conformation, which is in line with fluorescence polarization experiments, showing that peptides can still bind to IRE1 LD Q105C SS where a disulfide bridge locks the dimer’s central groove.25
We found that the Y161R mutation destabilizes the binding of MPZ1N-2X by reducing the interactions between the unfolded peptide and the central region of the hIRE1α cLD dimer. The residue Y161 is situated near L186, which is recognized as a critical hotspot for peptide binding based on PRE experiments with hIRE1α.14 In addition, a mutation in the corresponding residue in yIre1 negatively affects protein activation.12 Our findings indicate that the Y161R mutation partially impairs peptide binding and may lead to a reduced binding affinity. However, it is important to note that since peptide binding relies on multiple low-affinity interactions, a single point mutation is unlikely to completely eliminate the binding ability.
We conducted further exploration of the intermolecular interactions involved in the early stages of hIRE1α activation. During this process, the protein interacts with unfolded proteins, other hIRE1α monomers and dimers, and BiP. Unfolded proteins may serve as linkers between cLD dimers under ER stress,23 and Kettel et al. demonstrated that short peptides can facilitate clustering. 26 Based on the knowledge acquired here on key contact sites, we constructed a system where MPZ1N-2X peptide could maintain a stable interaction with two dimers at the same time. We speculate that unfolded proteins might bring dimers together in an early stage of ER stress and cluster formation, establishing assemblies with no defined stoichiometry or conformation. Structured oligomers, as observed in crystals by Credle et al.12 and in situ by Tran et al.,11 might arise at later stages after allosteric rearrangement.14 On the other hand, we showed that a complex formed by cLD and BiP, as predicted by AlphaFold, is stable in equilibrium simulations. These findings are in line with the work of Amin-Wetzel et al. and Dawes et al., 25,48 who implied that DR2 should be involved in interactions with BiP. Kettel et al. 26 showed that mutating residues 312TLPL315, which partially overlap with the predicted interaction interface, is detrimental to the formation of condensates and higher-order oligomers. These results hint at the role of BiP in disrupting the oligomers by shielding the DR2 and αB-helices, effectively blocking the oligomeric interface. Unfortunately, we noted that AlphaFold 3 clearly does not distinguish between states determined by the binding of different small ligands.49
Recently, Simpson et al. identified a new binding site for cholera toxin on hIRE1α cLD,28 which competes with C-terminal residues I362-P368. Here, however, we propose a different peptide binding mechanism that does not involve disordered regions, which could be a mode of action of a different set of peptides.26 Indeed, the motif identified by Simpson et al. (YGWYXXH) is not recognizable in the model peptides studied here.
Our equilibrium atomistic molecular dynamics simulations are unbiased and provide a high level of detail. However, time scale limitations restrict our ability to observe the slower conformational rearrangements of the protein complexes analyzed here. We employed a force field designed for disordered and unfolded proteins,40 but some bias could still exist. This could potentially lead to an overestimation of protein-protein interactions and hinder our observation of peptide dissociation in cases of intermediate binding affinities.
While here we focused on the activation of the UPR by an excessive accumulation of unfolded proteins, Ire1’s actiation is also triggered by a perturbation of the membrane composition of the ER.50,51 Future work will focus on investigating a structural model that explains how Ire1 can integrate molecular stress signals both from the ER lumen and its membrane.
In summary, our research endorses a model for the activation of human IRE1α, where pre-existing dimers in the ER lumen directly engage with accumulating unfolded proteins via the cLD. These interactions could promote dimer aggregation and initiate the formation of larger supra-molecular assemblies. Furthermore, our structural data suggest that BiP may inhibit IRE1 from forming oligomers while allowing dimer presence. Therefore, the dissociation of hIRE1α dimers from BiP, followed by their direct engagement with unfolded proteins, might facilitate the nucleation of assemblies that act as precursors to organized oligomeric structures (Fig. 6). In conclusion, our results provide a comprehensive framework to understand the structural dynamics of the Ire1’s activation.

Schematic illustrating the proposed sequence of events occurring in the early stages of hIRE1α activation within the ER lumen.
Before the onset of ER stress conditions, hIRE1α is prevented from forming assemblies by the chaperone BiP, which occupies the cLD’s oligomeric interface. As ER stress begins, unfolded proteins start to accumulate in the ER lumen, and pre-formed hIRE1α cLD dimers are released from BiP. Now, hIRE1α can interact with unfolded proteins, which brings multiple copies of the protein together to allow the formation of larger assemblies.

(A) Superposition of AF model (light violet) and PDB model (orange) of the hIRE1α cLD dimer before the simulation (RMSD = 3.34 Å). (B) Superposition of cLD dimer models predicted by AlphaFold 2 Multimer (light violet) and AlphaFold 3 (dark violet). (C) PDB model of the hIRE1α cLD dimer after 2 µs of production run from one of the TIP3P replicas. (D) AF model of the hIRE1α cLD dimer after 2 µs of production run from one of the TIP3P replicas. (E) Details of the dimeric interface of the hIREα cLD dimer, consisting of an antiparallel β-sheet with four hydrogen bonds between residues G119-D123. The renders show the dimer interface in the AF model (upper row) and of the PDB model (lower row) prior to energy minimization and production run (t = 0 µs) and after 2 µs of simulation. The backbone atoms of residues G119-D123 are in licorice (C cyan, H white, O red, N blue) and the rest of the structure is rendered as a transparent ribbon. The backbone of the protein is shown as transparent cartoon. (F) Hydrogen bond analysis of all the hIREα cLD dimer simulation replicas. This analysis shows the distance between donor and acceptor atoms (left y-axis, blue line) and the angle between donor-hydrogen-acceptor (right y-axis, orange line) for all replicas of PDB and AF models in TIP3P and TIP4P-D water. The hydrogen bonds analyzed here are those formed at the dimeric interface by residues G119, K121, and N123. The horizontal blue and orange lines indicate, respectively, the ideal distance (3.2 Å) and angle (180°) for a hydrogen bond. Whenever the distance is greater than 3.2 Å or the angle is lower than 120°, the frame is highlighted by a grey or red vertical bar, respectively. Therefore, the vertical bars indicate when the hydrogen bond is lost. The data are plotted every 50th frame for the lines and every frame for the vertical bars. (G) Early PDB model of the hIRE1α cLD dimer after 2 µs of production run. Replica showing a partial dissociation of the dimer. (H) Detail of the side of the dimeric interface of the early PDB model that dissociates during simulations. The side chains of residues L116, Y166, and W125 are highlighted in three different models: the early PDB model (gray), the final PDB model (orange), and the AlphaFold model (light violet). The backbone of the protein is shown as transparent cartoon. (I) The DR1 is folded in the AF model (Fig. 1B). The modified AF model with unfolded DR1 (left, t = 0 µs). The AlphaFold model with unfolded DR1 is stable after 500 ns of simulation (right, t= 500 µs).

(A) Visualization of the discrepancy values from Fig. 1C for TIP3P water onto the molecular structures of the PDB and AF models. Shades of blue indicate that the simulated structure is more flexible and solvent accessible with respect to what was reported from experiments, while red indicates that the simulated structure is more rigid and less solvent accessible than expected. (B) Comparison of deuterated fraction from Amin-Wetzel et al. with deuterated fraction computed from MD simulations (See Method section ‘HDX data comparison’). For each residue, the plot indicates which model gives the better agreement with experimental data (‘best structure’) at each of the time points examined, t = 0.5 min, 5 min or both. The histogram plots the cumulative number of residues that are the closest to experimental data for each model and water. (C) Table comparing the models’ ability to reproduce experimental data. The four variants of the model are compared residue-wise, at both time points, and each model gets a point if it can reproduce the experimental deuterated fraction of a given residue better than the other three models. Points are summed for each model at both time points to get the total. The total score is the value plotted in the histogram in Supplementary Fig.8B. (D) Best structural model of hIRE1α cLD dimer: the colors highlight the best structural representation of each residue at either time point, as plotted in Supplementary Fig.8B.

(A) Probability density distribution of the groove width of: hIRE1α cLD dimer (AlphaFold model) computed between Cα of Q105 during simulations in TIP3P and TIP4P-D water (top panel); hIRE1α cLD dimer (PDB model) computed between Cα of Q105 during simulations in TIP3P and TIP4P-D water (middle panel); yIre1 luminal domain dimer computed between Cα of S200 during simulations in TIP3P and TIP4P-D water (bottom panel). Dashed lines indicate the groove width of the dimer model prior to energy minimization. (B) Representative Q105 side chains arrangements during simulations of the human cLD dimer AlphaFold model (top row) and of the PDB model (bottom row), snapshots are taken from three independent replicas in TIP3P and TIP4P-D.

(A) Additional examples of peptide binding. Here, we report snapshots from simulations at the initial timestep (t= 0 µs) and final timestep (t= 1 µs) of the unfolded peptides not shown in Fig. 3A-C, in order: Valine8, MPZ1-N (perpendicular placement), MPZ1-C, 8ab1, OR-1, V1rb2-1, V1rb2-2. Heterogeneous binding. Peptides that are unstable in the central groove placement tend to rearrange to different parts of IRE1, either to the side of the groove as for V1rb2-1 and MPZ1-C or to the outer part of the dimer in the proximity of the αB-helices, as in the case of MPZ1N-2X-RD. (C) Available binding affinities (K1/2) of the unfolded polypeptides studied to hIRE1α.14,26 (D) Prediction of AlphaFold 3 for hIRE1α cLD dimer in complex with peptide MPZ1N-2X. Colors represent the confidence of the prediction (plDDT). (E) Distributions of the groove width of peptide-bound cLD dimers throughout all simulations performed.

(A) Analysis of contacts between unfolded peptide and cLD dimer for all MD simulations performed in TIP3P water. The contact score reported on the AlphaFold model of the cLD dimer was obtained by computing the contacts from all the simulations, summing them, and normalizing them by the number of frames. Lower values indicate fewer contacts observed. (B) Contact analysis of MPZ1N-2X in complex with wild-type hIRE1α cLD dimer. (C) Contact analysis of MPZ1N-2X in complex with Y161R hIRE1α cLD dimer. The analysis of panels B and C took into consideration all six 1 µs-long replicas in TIP3P and TIP4P-D water for each system.

(A) Prediction of AlphaFold 3 for hIRE1α cLD monomer in complex with ATP-bound BiP. The colors are as in Fig. 5B. (B) Prediction of AlphaFold 3 for hIRE1α cLD monomer in complex with ADP-bound BiP. (C) Prediction of AlphaFold 3 for hIRE1α cLD monomer in complex with BiP not bound to any nucleotide. (D) Structure of hIRE1α cLDBiP- ATP after 2 μs of simulation. (E) Structure of hIRE1α cLD-BiP-ADP after 2 μs ofsimulation. (F) Structure of hIRE1α cLD-BiP after 2 μs of simulation.
Methods
MD simulations
We performed all atomistic molecular dynamics simulations using GROMACS 2021.452 and the Charmm36m force field. 53 All systems were set up with explicit solvent, TIP3P 42 or TIP4P-D40 water model, and 0.15 M NaCl, adding to the number of ions needed for a neutral total net charge of the system. The TIP4P-D water model was taken from the work of Piana et al.40 and inserted into the Charmm36m force field parameters by setting the parameters for the oxygen atom OWT4PD Lennard-Jones interactions to ϵ = 0.9365543 kJ/mol and σ = 0.316499897100 nm and using a modified itp file of the TIP4P/2005 water model54 (available at http://catalan.quim.ucm.es/), setting the charge of H atoms to 0.58 and the charge of the dummy atom to -1.16. The solvation in TIP3P was done using CHARMM-GUI, 55 while the solvation in TIP4P-D was done using GROMACS tools and in-house bash scripts. The systems were minimized using the steepest descent algorithm and equilibrated in the NVT ensemble with position restraints (on the backbone and side chains) for 0.125 ns with a 1 fs time step at 300 K. The production runs were performed in the NPT ensemble. The systems were maintained at a temperature of 300 K using the velocity rescale thermostat56 (τ T = 1 ps) and at 1 bar using the Parrinello-Rahman barostat57 (τ P = 5 ps).
IRE1α core Luminal Domain (cLD) structural models
Human PDB dimer
The protein structure of the human IRE1α core Luminal Domain (cLD) dimer was obtained from the Protein Data Bank, PDB ID 2HZ6. 24 The missing residues were modeled using Modeller in UCSF Chimera58 (version 1.15 and 1.17), and they included disordered regions 1 and 2 in residues 131-152 and 308-357 and three connecting loops in residues 66-70, 89-90, and 11-115.
An early model was briefly equilibrated in NPT, and a conformation with a groove width of approximately 0.6 nm was selected. This snapshot was used as the initial structure for the early “PDB model” simulations, in which the dimer dissociates.
The final PDB model was obtained from the deposited crystal structure, adding missing residues with Modeller in UCSF Chimera independently for the two monomers and not allowing residues at the borders of the missing areas to rearrange during modeling. This model was then directly used for simulation setup, producing the stable cLD dimer used here.
Human AlphaFold dimer
We obtained the AlphaFold prediction of the human IRE1α cLD dimer (“AF model”) by running AlphaFold 2 Multimer 33,34 in the ColabFold36 notebook v1.5.5 using MMseq2 (https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) with disabled template usage.
The structures of the five top models were predicted, and the first one was chosen for simulation. The input sequence was (Uniprot identifier O75460): PETLLFVSTLDGSLHA VSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIP ELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRT EYTITMYDTKTRELRWNATYFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESG DVLWIQNYASPVVAFYVWQREGLRKVMHINVAVETLRYLTFMSGEVGRITKWKYP FPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTI GDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWLLIGHHETP.
For the prediction of the AlphaFold 3 model of human IRE1α cLD dimer we used the AlphaFold server59 at hhttps://alphafoldserver.com/ with same input sequence as for AlphaFold 2.
Yeast PDB dimer
The protein structure of the yeast Ire1 Luminal Domain dimer was obtained from the Protein Data Bank entry 2BE1.12 The system was set up using CHARMM-GUI, which was also used to add missing residues (210-219, 255-274, 380-387). The model simulated here spans residue 111 to 449 (Uniprot identifier P32361).
DR1-loop AlphaFold dimer
The model of the human IRE1α cLD dimer predicted by the AlphaFold multimer was modified by removing the DR1 (residues 131-152) and adding them again as unstructured loops, using Modeller in UCSF Chimera58 (version 1.17.3).
Human IRE1α cLD in complexes
Unfolded peptides
For the binding experiments, we created an unfolded and stretched structure from the sequence of interest using the UCSF Chimera ‘Build structure’ tool. The peptides we simulated mimicked unfolded peptides, so no specific secondary structure was imposed. The stretched-out configuration was obtained by setting the seed for ϕ/ψ dihedrals with values for antiparallel β strand to obtain angles ϕ = -139 and ψ = 135 for all the residues. Then, we manually placed the peptides above the binding groove of the AF model of human IRE1α cLD dimer. The sequences of the peptides used are: valine8, VVVVVVVV; MPZ1-N, LIRYAWLRRQAA; MPZ1N-2X, LIRYAWLRRQAALQRRLIRYAWLRRQAA; MPZ1N-2X-RD, LIDYAWLDDQAALQDDLIDYAWLDDQAA; MPZ1-C, LQRRISAME; 8ab1, WLCAL-GKVLPFHRWHTMV; OR-1, MEKAVLINQTSVMSFR; V1rb2-1, MFMPWGRWNSTTC-QSLIYLHR; V1rb2-2, LKFKDCSVFYFVHIIMSHSYA.
For the prediction of the AlphaFold 3 model of human IRE1α cLD dimer in complex with MPZ1N-2X, we used the AlphaFold server 59 at https://alphafoldserver.com/ with same input sequences as for AlphaFold 2.
Y161R AlphaFold dimer and MPZ1N-2X peptide
We created the mutant Y161R of human IRE1α cLD dimer by substituting the tyrosine residue at position 161 on both monomers with arginines in the AlphaFold dimer model in complex with the unfolded peptide MPZ1N-2X, utilizing the mutation options in CHARMM-GUI,55 during the setup of the system.
Two dimers and MPZ1N-2X peptide
The system, which contains two copies of the AF model of the human IRE1α cLD dimer and one copy of the unfolded peptide MPZ1N-2X, was obtained by manually arranging the copies in UCSF Chimera. 58
cLD monomer in complex with BiP
The BiP-cLD heterodimer was obtained using ColabFold36 v1.5.5: AlphaFold2 Multimer 33,34 using MMseq2 with default options. The hIRE1α cLD sequence used is the same used for predicting the dimer: the PDB 2HZ6 sequence, Uniprot identifier O75460 with mutations C127S and C311S, and residues P29-P368. The BiP sequence used is taken from UniProt identifier P11021, residues M1-L654. Simulations of the BiP-cLD complex were run only in TIP4P-D water.
For the prediction of the AlphaFold 3 model of human IRE1α cLD monomer in complex with BiP, we used the AlphaFold server59 at https://alphafoldserver.com/ with same input sequences as for AlphaFold 2 and adding ADP or ATP to the prediction reques.
Hydrogen - deuterium exchange fractions calculation from MD simulations
We based our HDX-MS data analysis on the method developed by Bradshaw et al. 44 to compare experimental HDX-MS data to simulations. We exploited the first part of the pipeline (script ‘calc hdx.py’) to compare our simulation results for the trajectories concerning the cLD dimer to the experimental data from Amin-Wetzel et al. 25 To reproduce the time points after incubation in deuterium (D2O), we computed deuterated fractions separately for each of the two monomers constituting a dimer for the time points 0.5 min (30 s) and 5 min (300 s). Then, we computed the average and standard error of the mean over the data coming from replicas of the same cLD dimer model (AF or PDB model) and the same water model (TIP3P or TIP4P-D). We computed the difference between simulation and experimental data (deuterated fraction discrepancy), and for each residue, we selected as the ‘best structure’ the model with the discrepancy closest to zero among PDB-TIP3P, PDB-TIP4P-D, AF-TIP3P, and AF-TIP4P-D systems.
Groove width analysis
To monitor the groove width, we calculated the Euclidean distance between the Cα atoms of residues Q105 belonging to the two monomers forming the hIRE1α cLD dimer at every frame of the trajectory. For the analysis of the yeast Ire1 cLD dimer groove, we computed the distance between the Cα atoms of the residues S200 belonging to the two monomers (PDB ID 2BE112).
Groove-peptide distance analysis
We measured the groove-peptide distance as the minimum distance between any residue belonging to the helices flanking the central groove (residues P101-S107) and any residue of the unfolded peptide. To analyze the groove width and groove-peptide distances, we used MDAnalysis60,61 (version 2.3.0) and custom Python scripts.
Analysis of cLD dimer-peptides contacts
We assessed the interactions between the cLD dimer and unfolded peptides throughout the simulations using the Python package MDTraj62 (version 1.9.5). A contact was deemed to occur when two heavy atoms (hydrogens were excluded from the analysis) were found at a distance of less than 0.45 nm. For each 10th frame of a simulation replica, a contact map for all heavy atoms was computed, with binary values for the presence or absence of a contact. These contact maps per frame were summed together and normalized by the number of frames to obtain the frequency of contacts for a given simulation replica. To obtain a ranking of the cLD amino acids in contact with unfolded peptides, the contact map was reduced to one dimension by summing all the contributions from all peptide residues and normalizing by the number of atoms in the peptide, resulting in an array matching the dimensions of the cLD dimer. Next, the 1-dimensional contact maps from all replicas were summed together and normalized by the number of replicas to obtain the final ‘contact score’ and ranking.
Data availability statement
All input files, analysis script, and data presented in this work are freely available at https://doi.org/10.5281/zenodo.14946897.
Acknowledgements
We thank Jan Stuke for the helpful insights and discussions. E.S. and R.C. acknowledge the support of Goethe University Frankfurt, the Frankfurt Institute of Advanced Studies, the LOEWE Center for Multiscale Modelling in Life Sciences (CMMS) of the state of Hesse, and the CRC 1507: Membrane-associated Protein Assemblies, Machineries, and Supercomplexes (P09), as well as computational resources and support from the Center for Scientific Computing of the Goethe University and the Jülich Supercomputing Centre. This research was funded in whole or in part by the Austrian Science Fund (FWF) [FWF-W1261, FWF-SFB F79] to G.E.K.
Additional information
Author Contributions
E.S. performed the modeling of the systems, planned and carried out the molecular dynamics simulations. E.S. analyzed the simulation data and produced figures. R.C. supervised the design of simulation experiments. G.E.K. advised and contributed to the scientific discussion. E.S., R.C., and G.E.K. wrote the manuscript.
Supporting Information Available
The molecular dynamics data presented in this work are available at https://doi.org/10.5281/zenodo.14946897
References
- (1)Mechanisms, regulation and functions of the unfolded protein responseNature Reviews Molecular Cell Biology 21:421–438Google Scholar
- (2)Calcium as a reliable marker for the quantitative assessment of endoplasmic reticulum stress in live cellsJournal of Biological Chemistry 296Google Scholar
- (3)Revealing the redox status in endoplasmic reticulum by a selenium fluorescence probeJournal of Materials Chemistry B 8:2660–2665Google Scholar
- (4)ER chaperone functions during normal and stress conditionsJournal of Chemical Neuroanatomy 28:51–65Google Scholar
- (5)The Unfolded Protein Response: From Stress Pathway to Homeo-static RegulationScience 334:1081–1086Google Scholar
- (6)Cloning of mammalian Ire1 reveals diversity in the ER stress responsesThe EMBO Journal 17:5708–5717Google Scholar
- (7)Complementary Signaling Pathways Regulate the Unfolded Protein Response and Are Required for C. elegans DevelopmentCell 107:893–903Google Scholar
- (8)Messenger RNA targeting to endoplasmic reticulum stress signalling sitesNature 457:736–740Google Scholar
- (9)Mammalian endoplasmic reticulum stress sensor IRE1 signals by dynamic clusteringProceedings of the National Academy of Sciences 107:16113–16118Google Scholar
- (10)Structural and functional basis for RNA cleavage by Ire1BMC Biology 9:47Google Scholar
- (11)The stress-sensing domain of activated IRE1a forms helical filaments in narrow ER membrane tubesScience 374:52–57Google Scholar
- (12)On the mechanism of sensing unfolded protein in the endoplasmic reticulumProceedings of the National Academy of Sciences 102:18773–18784Google Scholar
- (13)Unfolded Proteins Are Ire1-Activating Ligands That Directly Induce the Unfolded Protein ResponseScience 333:1891–1894Google Scholar
- (14)An unfolded protein-induced conformational switch activates mammalian IRE1eLife 6:e30700https://doi.org/10.7554/eLife.30700Google Scholar
- (15)Transcriptional induction of genes encoding endoplasmic reticulum resident proteins requires a transmembrane protein kinaseCell 73:1197–1206Google Scholar
- (16)XBP1 mRNA Is Induced by ATF6 and Spliced by IRE1 in Response to ER Stress to Produce a Highly Active Transcription FactorCell 107:881–891Google Scholar
- (17)IRE1 couples endoplasmic reticulum load to secretory capacity by processing the XBP-1 mRNANature 415:92–96Google Scholar
- (18)Decay of Endoplasmic Reticulum-Localized mRNAs During the Unfolded Protein ResponseScience 313:104–107Google Scholar
- (19)Ire1-mediated decay in mammalian cells relies on mRNA sequence, structure, and translational statusMolecular Biology of the Cell 26:2873–2884Google Scholar
- (20)Integrating the mechanisms of apoptosis induced by endoplasmic reticulum stressNature Cell Biology 13:184–190Google Scholar
- (21)The role of endoplasmic reticulum stress in human pathologyAnnual Review of Pathology: Mechanisms of Disease 10:173–194Google Scholar
- (22)Early events in the endoplasmic reticulum unfolded protein responseCold Spring Harbor Perspectives in Biology 11Google Scholar
- (23)The unfolded protein response: Detecting and responding to fluctuations in the protein-folding capacity of the endoplasmic reticulumCold Spring Harbor Perspectives in Biology 11Google Scholar
- (24)The crystal structure of human IRE1 luminal domain reveals a conserved dimerization interface required for activation of the unfolded protein responsePNAS Google Scholar
- (25)Unstructured regions in IRE1 specify BiP-mediated destabilisation of the luminal domain dimer and repression of the UPReLife 8Google Scholar
- (26)Disordered regions in the IRE1 ER lumenal domain mediate its stress-induced clusteringThe EMBO Journal 43:4668–4698Google Scholar
- (27)Antigen-derived peptides engage the ER stress sensor IRE1 to curb dendritic cell cross-presentationJournal of Cell Biology 221:e202111068Google Scholar
- (28)IRE1 recognizes a structural motif in cholera toxin to activate an unfolded protein responseJournal of Cell Biology 223:e202402062Google Scholar
- (29)Endoplasmic reticulum stress activates human IRE1 through reversible assembly of inactive dimers into small oligomerseLife 11Google Scholar
- (30)Dynamic interaction of BiP and ER stress transducers in the unfolded-protein responseNature Cell Biology 2:326–332Google Scholar
- (31)Dissociation of Kar2p/BiP from an ER Sensory Molecule, Ire1p, Triggers the Unfolded Protein Response in YeastBiochemical and Biophysical Research Communications 279:445–450Google Scholar
- (32)Structure and molecular mechanism of ER stress signaling by the unfolded protein response signal activator IRE1Frontiers in Molecular Biosciences 6Google Scholar
- (33)Protein complex prediction with AlphaFold-MultimerbioRxiv Google Scholar
- (34)Highly accurate protein structure prediction with AlphaFoldNature 596:583–589Google Scholar
- (35)Protein Data Bank: the single global archive for 3D macromolecular structure dataNucleic Acids Research 47:D520–D528Google Scholar
- (36)ColabFold: Making Protein folding accessible to allNature Methods 19:679–682Google Scholar
- (37)Encyclopedia of Computational ChemistryGoogle Scholar
- (38)CHARMM: A program for macromolecular energy, minimization, and dynamics calculationsJournal of Computational Chemistry 4:187–217Google Scholar
- (39)Recent Force Field Strategies for Intrinsically Disordered ProteinsJournal of Chemical Information and Modeling 61:1037–1047Google Scholar
- (40)Water dispersion interactions strongly influence simulated structural properties of disordered protein statesJournal of Physical Chemistry B 119:5113–5123Google Scholar
- (41)Choice of Force Field for Proteins Containing Structured and Intrinsically Disordered RegionsBiophysical Journal 118:1621–1633Google Scholar
- (42)Comparison of simple potential functions for simulating liquid waterThe Journal of Chemical Physics 79:926–935Google Scholar
- (43)Recommendations for performing, interpreting and reporting hy-drogen deuterium exchange mass spectrometry (HDX-MS) experimentsNature Methods 16:595–602Google Scholar
- (44)Interpretation of HDX Data by Maximum-Entropy Reweighting of Simulated Structural EnsemblesBiophysical Journal 118:1649–1664Google Scholar
- (45)Endoplasmic Reticulum Stress Sensing in the Unfolded Protein ResponseCold Spring Harbor Perspectives in Biology 5:a013169Google Scholar
- (46)Olfactory and Vomeronasal Receptor Feedback Employ Divergent Mechanisms of PERK ActivationbioRxiv Google Scholar
- (47)Experimental and Computational Modeling of H-Bonded Arginine–Tyrosine Groupings in Aprotic EnvironmentsACS Omega American Chemical Society 2:5641–5659Google Scholar
- (48)Chaperone BiP controls ER stress sensor Ire1 through interactions with its oligomersLife Science Alliance 7Google Scholar
- (49)Close and Allosteric Opening of the Polypeptide-Binding Site in a Human Hsp70 Chaperone BiPStructure 23:2191–2203Google Scholar
- (50)Activation of the Unfolded Protein Response by Lipid Bilayer StressMolecular Cell 67:673–684Google Scholar
- (51)Cysteine cross-linking in native membranes establishes the transmembrane architecture of Ire1Journal of Cell Biology 220:e202011078Google Scholar
- (52)GROMACS: High performance molecular simulations through multi-level parallelism from laptops to supercomputersSoftwareX 1-2:19–25Google Scholar
- (53)CHARMM36m: an improved force field for folded and intrinsically disordered proteinsNature Methods 14:71–73Google Scholar
- (54)A general purpose model for the condensed phases of water: TIP4P/2005The Journal of Chemical Physics 123:234505Google Scholar
- (55)CHARMM-GUI: A web-based graphical user interface for CHARMMJournal of Computational Chemistry 29:1859–1865Google Scholar
- (56)Canonical sampling through velocity rescalingThe Journal of Chemical Physics 126:014101Google Scholar
- (57)Polymorphic transitions in single crystals: A new molecular dynamics methodJournal of Applied Physics 52:7182–7190Google Scholar
- (58)UCSF Chimera—A visualization system for exploratory research and analysisJournal of Computational Chemistry 25:1605–1612Google Scholar
- (59)Accurate structure prediction of biomolecular interactions with AlphaFold 3Nature :1–3Google Scholar
- (60)MDAnalysis: A Python Package for the Rapid Analysis of Molecular Dynamics SimulationsIn: scipy Google Scholar
- (61)MDAnalysis: A toolkit for the analysis of molecular dynamics simulationsJournal of Computational Chemistry 32:2319–2327Google Scholar
- (62)MDTraj: A Modern Open Library for the Analysis of Molecular Dynamics TrajectoriesBiophysical Journal 109:1528–1532Google Scholar
Article and author information
Author information
Version history
- Preprint posted:
- Sent for peer review:
- Reviewed Preprint version 1:
- Reviewed Preprint version 2:
Cite all versions
You can cite all versions using the DOI https://doi.org/10.7554/eLife.106716. This DOI represents all versions, and will always resolve to the latest one.
Copyright
© 2025, Spinetti et al.
This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.
Metrics
- views
- 893
- downloads
- 37
- citations
- 0
Views, downloads and citations are aggregated across all versions of this paper published by eLife.