Unstructured regions in IRE1α specify BiP-mediated destabilisation of the luminal domain dimer and repression of the UPR

  1. Niko Amin-Wetzel
  2. Lisa Neidhardt
  3. Yahui Yan
  4. Matthias P Mayer
  5. David Ron  Is a corresponding author
  1. University of Cambridge, United Kingdom
  2. DKFZ-ZMBH Alliance, Germany

Abstract

Coupling of endoplasmic reticulum (ER) stress to dimerisation-dependent activation of the UPR transducer IRE1 is incompletely understood. Whilst the luminal co-chaperone ERdj4 promotes a complex between the Hsp70 BiP and IRE1’s stress-sensing luminal domain (IRE1LD) that favours the latter’s monomeric inactive state and loss of ERdj4 de-represses IRE1, evidence linking these cellular and in vitro observations is presently lacking. We report that enforced loading of endogenous BiP onto endogenous IRE1α repressed UPR signalling in CHO cells and deletions in the IRE1α locus that de-repressed the UPR in cells, encode flexible regions of IRE1LD that mediated BiP-induced monomerisation in vitro. Changes in the hydrogen exchange mass spectrometry profile of IRE1LD induced by ERdj4 and BiP confirmed monomerisation and were consistent with active destabilisation of the IRE1LD dimer. Together, these observations support a competition model whereby waning ER stress passively partitions ERdj4 and BiP to IRE1LD to initiate active repression of UPR signalling.

eLife digest

Cells produce many protein molecules. These are made of chains of building blocks called amino acids that then fold into three-dimensional shapes. Specialist proteins known as chaperones assist this folding process. For example, the chaperone BiP helps other proteins fold in a compartment within the cell called the endoplasmic reticulum.

To match the supply of chaperones to the demand of unfolded proteins, cells have stress receptors, such as IRE1 in the endoplasmic reticulum. IRE1 responds to changing levels of unfolded proteins by generating signals that tell cells whether they need more chaperones. Previous studies in a test tube suggest that when levels of unfolded proteins are low, BiP represses IRE1 signalling. However, when the levels of unfolded proteins increase, the unfolded proteins compete with IRE1 for BiP, releasing the brake BiP imposes on IRE1 signalling. It remained unclear if BiP regulates IRE1 in the same way in living cells.

To address this question, Amin-Wetzel, Neidhardt et al. studied IRE1 signalling in mammalian cells grown in the laboratory. The experiments revealed that cells containing a modified version of IRE1 to which BiP binds more strongly had less IRE1 signalling. On the other hand, cells containing versions of IRE1 that BiP binds less well had more active IRE1 signalling. These findings suggest that in cells, as in the test tube, unfolded proteins and IRE1 compete for BiP binding. This relationship comprises a simple mechanism allowing cells to sense and respond to the burden of unfolded proteins in their endoplasmic reticulum.

Over time, the amount of unfolded proteins in the cell likely contributes to the development of aging-related diseases such as adult-onset diabetes. A better understanding of how cells handle unfolded proteins may lead to more effective treatments for these diseases.

Introduction

In eukaryotes, the endoplasmic reticulum (ER) is the central organelle for the synthesis of proteins destined for secretion and membrane insertion. The ER lumen harbours a specialised protein folding and processing machinery that constitutes the protein folding capacity of the ER. To ensure that the environment for productive protein maturation is maintained, both folding capacity and the inward flux of newly synthesised proteins are regulated by a pervasive negative feedback signalling pathway, the unfolded protein response (UPR) (Kozutsumi et al., 1988; Cox et al., 1997). In mammalian cells, this pathway involves three known signaling branches each directed by a unique signal transducer resident in the ER membrane, IRE1, PERK and ATF6. An imbalance between folding load and capacity (ER stress) activates these sensors initiating a rectifying transcriptional and translational response to defend protein-folding homeostasis in the compartment (reviewed in Walter and Ron, 2011). While details of downstream events and their physiological significance are relatively well characterised (reviewed in Wang and Kaufman, 2016), the molecular mechanisms of the earliest events in UPR activation remain incompletely understood.

IRE1, conserved in all eukaryotes and therefore the best-studied UPR transducer (Cox et al., 1993; Mori et al., 1993), detects ER stress via its luminal domain (IRE1LD), initiating dimerisation-dependent autophosphorylation of its cytosolic domain (Shamu and Walter, 1996). The subsequent allosteric activation of the cytosolic endoribonuclease domain (Lee et al., 2008) leads to unconventional splicing of the mRNA encoding the XBP1/HAC1 transcription factor (Cox and Walter, 1996; Yoshida et al., 2001; Calfon et al., 2002), thereby promoting translation of an effector that drives a conserved gene-expression program.

Two models have been put forth to describe how IRE1LD senses ER stress. A direct binding model posits that unfolded proteins act as ligands stabilising IRE1’s dimeric/oligomeric state thereby promoting its activation. This model is supported by the crystal structure of the core luminal domain from S. cerevisae IRE1, showing an IRE1LD dimer interface traversed by a groove with architectural similarity to the major histocompatibility peptide-binding complexes (MHCs) (Credle et al., 2005). Peptide ligands of the yeast IRE1LD have been identified and their addition to dilute solutions of yeast IRE1LD enhances the population of higher order species, although a clear shift from monomers to dimers was not readily observable (Gardner and Walter, 2011).

The luminal domain of the broadly expressed alpha isoform of human IRE1 (hIRE1αLD) also crystallises as a dimer, with an overall architecture similar to the yeast protein, however, barring conformational changes, the MHC-like groove is too narrow to accommodate a peptide (Zhou et al., 2006). Recently, peptides have been identified that bind hIRE1LD and affect its oligomeric state, as assessed by analytical ultracentrifugation (AUC). Moreover, nuclear magnetic resonance (NMR) reported on peptide-induced structural rearrangements within the hIRE1αLD that also affected residues near the MHC-like groove. Hence, it has been proposed that the structure of Zhou et al. (2006) represents a ‘closed’ conformation of the peptide-binding groove that can shift towards an ‘open’ state to allow peptide binding (Karagöz et al., 2017). However, a co-crystal structure of the ligand-bound yeast or human IRE1LD is not available and it remains unclear if and how peptide ligands affect hIRE1LD dimerisation, the first crucial step of its activation.

An alternative hypothesis posits that IRE1 is repressed by interacting with a major component of the ER folding machinery, the heat-shock protein (Hsp70) chaperone BiP. It is proposed that upon stress, unfolded proteins accumulate and compete for BiP interaction, thereby kinetically disrupting the inhibitory IRE1-BiP complex. This chaperone inhibition model draws parallels between the regulation of the UPR and its cytosolic counterpart, the heat-shock response, in which chaperones associate with the transcription factor Hsf1, in eukaryotes, and σ32, in bacteria, to interfere with their activity (Abravaya et al., 1992; Shi et al., 1998; Tomoyasu et al., 1998). This model is supported by an inverse correlation between ER stress-induced IRE1 activity and the amount of ER-localised BiP recovered in complex with it (Bertolotti et al., 2000; Okamura et al., 2000; Oikawa et al., 2009).

Further molecular insight into the chaperone inhibition mechanism was gained recently by the discovery of ERdj4 as an ER-localised J-domain protein that selectively represses IRE1 activity in vivo and loads BiP onto the IRE1LD, thereby promoting monomerisation in vitro (Amin-Wetzel et al., 2017). Whilst other modes of BiP binding to the IRE1LD have been proposed (Carrara et al., 2015; Kopp et al., 2018) the aforementioned observations suggest a mechanism in which BiP engages the IRE1LD as an Hsp70 substrate: ATP-bound BiP initially interacts with the IRE1LD with high kon and high koff rates and only captures IRE1LD as a substrate (in the ADP bound state, with low koff rates) after ERdj4 co-chaperone-instructed ATP hydrolysis. This model draws on the conventional view whereby J-domain proteins act as adaptors that enable efficient substrate recognition via their divergent targeting domains and subsequent binding of Hsp70s, promoted by their conserved J-domain that stimulates Hsp70’s ATPase activity (reviewed in Kampinga and Craig, 2010). J-domain co-chaperones act in concert with nucleotide exchange factors (NEFs, reviewed in Behnke et al., 2015) to accelerate Hsp70s’ cycles of substrate binding and release, resulting in substrate-selective ultra-affinity (Misselwitz et al., 1998; De Los Rios and Barducci, 2014), which is the basis for the assembly of Hsp70-substrate complexes.

Whilst ERdj4’s repressive action on IRE1 signalling in cells and its ability to promote a complex between IRE1LD and BiP that favours the former’s monomeric state in vitro fit the chaperone inhibition model, they remain correlative findings and may be causally unrelated. For example, it is possible that ERdj4’s repressive action in cells arises from its role in eliminating IRE1LD activating ligands and not from catalysing the repressed, monomeric IRE1LD-BiP complex observed in vitro. Here, in support of the chaperone inhibition model, we report that enforced targeting of endogenous BiP to endogenously-expressed IRE1LD represses UPR signalling in cells, thereby establishing that BiP can directly repress IRE1 in vivo and that features of the IRE1LD that specify its repression in cells also specify its ability to undergo actively-driven monomerisation by ERdj4 and BiP in vitro.

Results

BiP binding to IRE1LD represses IRE1 activity in cells

An inverse correlation between ER stress-induced IRE1 activity and the amount of BiP recovered in complex with it has been previously observed (Bertolotti et al., 2000; Okamura et al., 2000; Oikawa et al., 2009) but a causal link between BiP binding and IRE1 activity status had never been conclusively established. To assess the effect of BiP binding on the activity of IRE1 in vivo, we modified the endogenous Ern1 locus to encode an ER targeted J-IRE1 fusion protein consisting of IRE1α’s endogenous signal peptide, an N-terminally fused J-domain (derived from ERdj4) followed by the endogenous IRE1α coding sequence (Figure 1—figure supplement 1). The alpha isoform accounts for all measurable activity in CHO cells and is referred to as IRE1 hereafter. By employing this fusion protein, we expected to stimulate BiP’s ATPase activity in close proximity to the IRE1LD thereby promoting formation of an IRE1-BiP complex. As control, a point mutant ERdj4 J-domain was used that had the histidine of the highly conserved HPD motif replaced by glutamine (JQPD) compromising the stimulation of BiP‘s ATPase activity (Wall et al., 1994). The glycine-phenylalanine-rich (G/F) region of ERdj4 was included as a flexible linker, to allow the J-domain to explore the entire surface of IRE1LD. We deemed that low level expression of endogenous IRE1 (and hence J-IRE1) would minimise IRE1-independent effects of this chimeric J-domain protein on the ER folding environment, effects that could not be excluded as having contributed to the previously-noted repressive effect of ERdj4 over-expression on the UPR (Amin-Wetzel et al., 2017).

Using an Ern1 null cell line with a genomic deletion encompassing the IRE1LD-encoding exons 2–12 (ΔIRE1, previously described in Kono et al., 2017), we reconstituted the endogenous locus with either wild-type IRE1, J-IRE1 or JQPD-IRE1 fusion. Additionally, the cell lines stably expressed XBP1s::Turquoise and CHOP::GFP reporters that are controlled by the IRE1 and PERK UPR branches, respectively. Flow cytometry analysis showed that reconstitution of the locus with wild-type IRE1 rescues the non-responsive XBP1s::Turquoise phenotype of the ΔIRE1 cells towards stress induced by tunicamycin (Figure 1A). In comparison, cells expressing the J-IRE1 fusion showed low XBP1::Turquoise reporter levels, indicating repressed IRE1 activity, even under stress. Repression was dependent on the integrity of the J-domain as ΔIRE1 cells reconstituted with the mutant JQPD-IRE1 acquired nearly wild-type stress responsiveness. The J-IRE1 protein was not otherwise compromised, as it was still able to respond to the ER stressor SubA, a protease that inactivates BiP by cleaving its interdomain linker (Paton et al., 2006) (Figure 1B). These findings are consistent with BiP serving as a direct trans-acting factor to specify repression mediated by a J-domain presented in cis to the IRE1LD.

Figure 1 with 1 supplement see all
Fusion of ERdj4’s J-domain to IRE1LD promotes efficient BiP association thereby repressing IRE1 activity in cells.

(A) Two dimensional plots of CHOP::GFP and XBP1s::Turquoise signals from CHO-K1 dual UPR reporter cells stably expressing the indicated IRE1 variants [IRE1 wild-type (wt), J-IRE1 or JQPD-IRE1 fusion; see Figure 1—figure supplement 1A, for schema of the alleles] from the endogenous Ern1 locus untreated and treated with the ER stressor tunicamycin (Tm). Clones used for the analysis were derived from an IRE1 null (ΔIRE1) parental cell line. A representative data set out of three independent experiments is shown. Note the low XBP1::Turquoise intensity in stressed J-IRE1 rescued ΔIRE1 cells. (B) Two dimensional plots of mCherry and XBP1s::Turquoise signals of clones described in ‘A’ transiently transfected with a plasmid encoding the SubA protease, which cleaves BiP at its interdomain linker and an mCherry fluorescent transfection marker. The inactive SubAS272A mutant was used as control. Representative data from nine biological repeats is shown. (C) Immunoblot (IB) of endogenous IRE1 and associated BiP recovered from the indicated cell lines by immunoprecipitation (IP) of IRE1. Quantification of the ratio of BiP to IRE1 signals in three independent experiments is shown on the right (mean ± standard deviation, n.s.: not significant, *: p<0.05, unpaired parametric Student’s t test). BiP in input cell lysates is provided as loading control. (Figure 1—source data 1) (D) Coomassie-stained SDS-PAGE gel of biotinylated IRE1LD (IRE1LD-bio) and a fusion of ERdj4’s J-domain to IRE1LD (J-IRE1LD-bio, as in ‘A’) and BiP, both recovered on a streptavidin matrix from samples constituted as indicated. Protein concentrations were 5 µM IRE1LD-bio variants, 30 µM BiP, 8 µM ERdj4, and 2 mM ATP. Proteins were eluted in SDS sample buffer. A representative data set out of three independent experiments is shown. (E) Time-dependent change in donor fluorescence of the indicated IRE1LD FRET pair incubated at t = 0 with the components shown to the right. IRE1LD proteins were either labelled with the donor molecule Oregon green 488 (OG) or the acceptor molecule TAMRA (TMR). Protein concentrations were 0.2 µM IRE1LD FRET pair, 30 µM BiP, 2.5 µM ERdj4 and 2 mM ATP. A representative graph of three independent experiments is shown (Figure 1—source data 2).

A role for the cis-active J-domain in recruiting BiP to the IRE1LD is supported by immunoprecipitation (IP) of endogenous IRE1 prepared from the cells described above. More BiP was recovered in complex with the J-IRE1 chimera compared to the wild-type IRE1 whilst the mutant JQPD-IRE1 fusion associated with a similar amount of BiP as the wild-type (Figure 1C), which is in accordance to their similar phenotype detected by flow cytometry.

To further validate these in vivo observations, we reconstituted the system in vitro using recombinant proteins purified from bacteria. First, pull down of either C-terminally biotinylated IRE1LD (IRE1LD-bio) or J-IRE1LD (J-IRE1LD-bio) was performed. We assessed the formation of a BiP-IRE1LD-bio complex on SDS-PAGE after recovery on immobilised streptavidin (Figure 1D). Whilst BiP recovery in complex with IRE1LD-bio was dependent on the presence of both ERdj4 and ATP in the binding assay, complex formation of BiP and J-IRE1LD-bio required only ATP.

Next, we tested how BiP binding affected J-IRE1LD’s oligomeric status in vitro using a Förster resonance energy transfer (FRET)-based assay to continuously monitor the monomer-dimer equilibrium (as described previously, Amin-Wetzel et al., 2017). A donor IRE1LD labelled with Oregon Green (OG) was pre-equilibrated either with an IRE1LD or J-IRE1LD acceptor molecule labelled with TAMRA (TMR). As previously observed, BiP, ERdj4, and ATP were all required to monomerise the IRE1LD homodimer as reflected in the time-dependent increase in donor fluorescence until a kinetically maintained pseudo steady state was reached (Figure 1E). In contrast, heterodimeric FRET pairs containing the J-IRE1LD fusion and IRE1LD were monomerised by BiP in an ATP-dependent manner, but did not require ERdj4 in trans. The nucleotide-dependent, BiP-induced monomerisation of the J-IRE1LD containing heterodimer occurred with an approximately four-fold higher initial velocity and a higher plateau in the pseudo steady state of the reaction. Taken together these findings suggest that the fused J-domain enables efficient formation of the IRE1LD-BiP complex, thereby promoting monomerisation, which leads to repression of IRE1 activity.

In vitro characterisation of direct binding of unfolded proteins to IRE1LD as modelled by the MPZ-N peptide

To examine the role of peptides in regulating the monomer-dimer equilibrium of IRE1LD and hence its activity, we turned to a 12-mer peptide (MPZ-N) derived from myelin protein zero. MPZ-N is the best studied ligand for mammalian IRE1LD and was recently proposed to directly interact with the peptide-binding groove thereby influencing IRE1LD‘s oligomeric status (Karagöz et al., 2017). When introduced into the FRET-based assay, MPZ-N had no measurable effect on donor fluorescence. However, as the optical readout of this assay is sensitive mostly to monomerisation (as reflected in an increase in donor fluorescence, Figure 1E) it would be a relatively insensitive measure of MPZ-N peptide driven dimerisation. Therefore, we sought different assays to report on the ability of the MPZ-N peptide to promote IRE1LD dimers.

The distribution of IRE1LD between monomers and dimers can be tracked by size exclusion chromatography (SEC), as evidenced by the concentration-dependence of the peak elution time of IRE1LD and two dimerisation-compromised mutants: a previously characterised W125A variant (Zhou et al., 2006) and a new, more severe P108A variant (Figure 2—figure supplement 1A). Both mutations are predicted to decrease hydrophobic interactions across the dimer interface (Figure 2—figure supplement 1B). Addition of MPZ-N peptide (at concentrations exceeding the reported K1/2 max for binding of 16 µM, Karagöz et al., 2017) did not affect the peak elution time of IRE1LD, itself introduced into the assay at 500 nM, near the Kd for IRE1LD dimerisation (Zhou et al., 2006) (Figure 2A and B).

Figure 2 with 2 supplements see all
Binding of MPZ-N peptide to IRE1LD does not promote IRE1LD dimerisation.

(A) Size-exclusion chromatography (SEC) elution profiles of TAMRA (TMR)-labelled wild-type IRE1LD at the indicated concentrations in presence and absence of MPZ-N peptide. TMR fluorescence is plotted against elution time (see: Figure 2—source data 1). (B) SEC elution profiles (as in ‘A’), but with protein absorbance at 280 nm (A280) plotted against elution time. The inset is a zoom into the segment of the chromatogram encompassing the IRE1LD proteins, whose absorbance is dwarfed by the peak of free peptide (eluting at ~24 min). The heterogenous peaks eluting between 15 and 20 min in the sample loaded with 1 mM MPZ-N peptide, likely reflected peptide oligomerisation (see: Figure 2—source data 1). (C) Cartoon representation of the IRE1LD dimer (PDB: 2HZ6) is shown on the left with coloured secondary structures (cyan for helices, red for sheets and magenta for loops). The Gln105 side chain is shown as sticks, a closer view of which is shown on the top right. The bottom right panel shows a similar view of the Gln105Cys mutant (crystallised here), which forms a disulphide bond, covered with clear electron density (black mesh represents the 2mFo − DFc map, contoured at 1.0 σ, including density within 2 Å of the cysteine residues). (D) Anisotropy of FAM labelled MPZ-N peptide (100 nM) in presence of increasing concentrations of either wild-type IRE1LD or disulphide-linked dimeric IRE1Q105C SS. Shown are data from three independent experiments (mean ± SD). Curve fitting was performed in Prism GraphPad 7.0 using Equation 2 in Materials and methods (see: Figure 2—source data 2).

To confirm these observations, we made use of an alternative assay reporting on IRE1LD’s dimerisation status. To this end, we employed a modified IRE1LD Q105C that forms a disulphide across the dimer interface, creating a covalently stabilised dimer when placed in oxidising conditions (Figure 2—figure supplement 1C) and the aforementioned dimerisation-compromised versions of the IRE1LD (W125A and P108A). Differential scanning fluorimetry (DSF) revealed that the melting temperature (Tm) of disulphide-linked IRE1LD Q105C SS was ~10 °C higher than the Tm the wild-type protein, a Tm difference that was effaced by reduction of the dimer-stabilising disulphide (Figure 2—figure supplement 1D). By contrast, the IRE1LD monomeric variants exhibited a T5–10 °C lower than the wild-type. These observations established a correlation between the monomer-dimer equilibrium and the Tm of the protein consistent with dimerisation-mediated stabilisation of the IRE1LD. A ligand, stabilising the IRE1LD dimer, is predicted to increase the Tm, however, addition of MPZ-N peptide had no effect on the Tm of IRE1LD (Figure 2—figure supplement 1D, the significance of the lowering of Tm observed at the highest concentrations of peptide remains to be determined).

To gain insight into the mode of MPZ-N binding to IRE1LD we made further use of the disulphide-linked IRE1LD Q105C SS. The crystallised IRE1LD Q105C SS dimer proved identical in structure to the wild-type protein (root-mean squared deviation (RMSD) of 0.46 Å over 227 Cα atoms) except for the presence of a conspicuous density corresponding to a C105-C105 trans-protomer disulphide, thereby locking the proposed binding groove in the ‘closed’ conformation (Figure 2C, Figure 2—figure supplement 1E and Table 1). Nonetheless, a fluorescence polarisation binding assay, using FAM-labelled MPZ-N, showed that binding to the IRE1LD was not compromised by the disulphide (Figure 2D), leading us to conclude that MPZ-N does not obligatorily bind within the proposed MHC-like groove of the IRE1LD. This conclusion is also consistent with the paramagnetic relaxation enhancement (PRE) experiments with IRE1LD and an MPZ-proxyl-labelled peptide (Karagöz et al., 2017), which present a distance constraint of 10 Å between Ile186 of the IRE1LD and the labelled Cys5 of the peptide. Figure 2—figure supplement 2 shows that the extended peptide is free to explore the entire surface of one face of the IRE1LD and may therefore bind in locations other than the MHC-like groove, without violating this distance constraint.

Table 1
Data collection and refinement statistics of IRE1LDQ105C SS.
Data collection
Synchrotron stationsDls i04-1
Space groupP6522
a,b,c; Å182.77, 182.77, 68.45
α, β, γ; ⁰90.00, 90.00, 120.00
Resolution, Å91.39–3.55 (3.89–3.55)*
Rmerge0.180 (2.242)*
I/σ(I)11.7 (1.5)*
CC1/21.000 (0.797)*
No. of unique reflections8590 (1996)*
Completeness, %100.0 (100.0)*
Redundancy19.3 (19.9)*
Refinement
Rwork/Rfree0.323/0.332
No. of atoms (non H)1784
Average B-factors127
RMS Bond lengths Å0.003
RMS Bond angles,⁰0.606
Ramachandran favoured region, %95.85
Ramachandran outliers, %0
MolProbity score†1.51 (100th)
PDB code6SHC
  1. * Values in parentheses are for highest-resolution shell.

    † 100† 100th percentile is the best among structures of comparable resolutions. 0th percentile is the worst.

Identification of regions in IRE1LD involved in BiP-mediated regulation of its activity

Given the evidence for BiP’s role in IRE1 repression, we tried to identify regions in IRE1LD that might be important for such regulation. BiP, as an Hsp70 chaperone, typically interacts with unfolded or flexible regions in its client proteins (Rüdiger et al., 1997) and we held that this might also be the case for its interaction with the IRE1LD. Therefore, we sought clues to map these flexible regions by collecting data on the structural dynamics of IRE1LD in solution as evaluated by hydrogen-1H/2H-exchange experiments in combination with mass spectrometry (HX-MS).

IRE1LD was pre-equilibrated for 30 min at 30°C followed by an exchange reaction in deuterium oxide (D2O) buffer for 30 and 300 s. Subsequent analysis of deuteron incorporation was performed as described previously (Hentze and Mayer, 2013). Information on peptic peptides covering 85% of the IRE1LD sequence was obtained (Table 2). The extracted percentage of exchange (%ex) for each peptic peptide contained information about the thermodynamic stability of structural elements, the hydrogen bonding and solvent accessibility of backbone amide hydrogens (Figure 3A left panel). Projection of these values onto the crystal structure showed that regions in the hydrophobic core exhibited significant protection from exchange (low %ex), whereas surface exposed areas were more dynamic (high %ex) (Figure 3A right panel). This method identified the region encompassing residues 303–378 as being especially flexible, a conclusion consistent with the observation that though it was present in the constructs used for crystallisation, residues 308–357 were resolved in neither the crystal structures of wild-type IRE1LD (Zhou et al., 2006) (Figure 3A right panel dotted line) nor the disulphide-linked IRE1LD Q105C SS variant here. Similar characteristics apply to residues 379–444, covering the so-called tail region that connects the structured core of the IRE1LD with the transmembrane domain (Figure 3A right panel dotted line and Figure 3—figure supplement 1A). Moreover, the latter residues overlap with a region of IRE1LD implicated in its basal repression in an overexpression cell-based assay (Oikawa et al., 2007; Oikawa et al., 2009).

Figure 3 with 1 supplement see all
Identification of flexible regions in IRE1LD that are important for the regulation of IRE1 activity in cells.

(A) Left panel shows a bar diagram of the percentage of amide hydrogen exchange (%ex) of the indicated by IRE1LD segments after 30 and 300 s incubation in D2O. The amino acids (aa) covered by the peptic fragments are indicated on the left. Exchange was corrected for back exchange using a fully deuterated IRE1LD preparation. Protein concentration was 5 µM. Shown are the data of three independent experiments (mean ± standard deviation). Right panel shows a cartoon of the IRE1LD dimer (PDB: 2HZ6) with the left protomer coloured according to %ex at 30 s (areas with no sequence coverage are uncoloured). The location of the putative loop (residues 308–357) and the tail (residues 390–444) are schematically represented as dotted lines (see: Figure 3—source data 1) (B) Schematic description of a directed in vivo CRISPR-Cas9 mutagenesis strategy to probe regions of IRE1LD for their relevance to regulating activity in CHO-K1 cells. Cas9 guides (red triangles) targeted sites across the Ern1 genomic locus encoding the protein’s region of interest. Transfection of individual or pairs of guides resulted in a collection of mutations (insertions and deletions, depicted as blue and red lines). Cell harbouring rare de-repressing mutations of IRE1 (blue) were selected by fluorescence-activated cell sorting (FACS) gated on XBP1s::Turquoise high and CHOP::GFP low signals. The resultant clones were isolated and genotyped. (C) Left panel is a histogram of XBP1s::Turquoise intensity of CHO-K1 dual UPR reporter cell populations transfected with guide-Cas9 encoding plasmids targeting a putative unstructured loop (aa 308–357) within IRE1LD (identified in ‘A’). XBP1s::Turquoise bright cells within population 0 were collected by FACS (FACS1) yielding population 1, followed by a second round of enrichment for bright cells (FACS2 yielding population 2). Population 2 was treated with the IRE1 inhibitor 4µ8c to select against clones exhibiting IRE1-independent reporter activity. The final population was genotypically analysed (representative sequences are shown on the right). Frameshift mutations are coloured in blue and Cas9 cut sites are indicated below.

Table 2
List of IRE1LD peptic peptides analysed by hydrogen-1H/2H-exchange mass spectrometry (HX-MS) containing the respective m/z values, charge (z) and sequence of each peptide.

Note that the N-terminal amide hydrogen of each peptic fragment exchanges too fast to be detectable with this method. Hence, the N-terminal residue was excluded from the data analysis.

ResiduesM/zZSequence
24–36631.3452STSTVTLPETLL
37–45938.4781FVSTLDGSL
46–59396.7304HAVSKRTGSIKWTL
77–85927.4351LPDPNDGSL
86–106779.0873YTLGSKNNEGLTKLPFTIPEL
96–106636.3802LTKLPFTIPEL
107–1191316.6801VQASPSRSSDGIL
120–128390.1993YMGKKQDIW
130–134735.4241YVIDLL
134–145631.8322LTGEKQQTLSSA
147–1571090.5631ADSLSPSTSLL
157–168730.8742LYLGRTEYTITM
168–175522.2422MYDTKTRE
176–183535.7722LRWNATYF
186–1951031.4471AASLPEDDVD
196–208727.8372YKMSHFVSNGDGL
209–221703.3432VVTVDSESGDVLW
221–232697.8562WIQNYASPVVAF
233–2401050.5371YVWQREGL
241–248332.8643RKVMHINV
253–258406.7352LRYLTF
280–287444.282KSKLTPTL
288–2961017.5251YVGKYSTSL
297–302655.2731YASPSM
303–316474.2683VHEGVAVVPRGSTL
317–335956.9782PLLEGPQTDGVTIGDKGES
343–360534.3074VKFDPGLKSKNKLNYLRN
365–378503.5883IGHHETPLSASTKM
379–404516.6066LERFPNNLPKHRENVIPADSEKKSFE
410–424810.3762VDQTSENAPTTVSRD
410–443727.1495VDQTSENAPTTVSRDVEEKPAHAPARPEAPVDSM

To probe the putative loop (residues 308–357) and the tail region (residues 390–444) for their importance in maintaining the repressed state of IRE1 in vivo, we devised a CRISPR-Cas9 mutagenesis strategy (Figure 3B). By targeting only unstructured regions within IRE1LD, we hoped to preserve the integrity of the core structure whilst favouring mutations that might de-repress IRE1 activity. After introducing a set of guide RNAs targeting the region of interest together with the Cas9 endonuclease into cells, error prone non-homologous end joining (NHEJ) resulted in a series of mutations, ranging from small in-frame indels at a single guide site to larger ones spanning two guide sites. The IRE1 reporter was used to select rare clones exhibiting a de-repressed IRE1 phenotype (XBP1s::Turquoise bright). The CHOP::GFP reporter was used to exclude clones exhibiting a general perturbation of ER protein homeostasis. Iterative rounds of fluorescence-activated cell sorting (FACS) enriched the XBP1s::Turquoise bright population. Clones that had acquired IRE1-independent XBP1s::Turquoise reporter expression were purged based on their unresponsiveness to the IRE1 inhibitor 4µ8c (Cross et al., 2012). The Ern1 locus of individual clones with deregulated IRE1 activity found in the final pool was sequenced (Figure 3C left panel). As expected, all the putative deregulating deletions/mutations maintained the frame of the IRE1 coding sequence (Figure 3C right panel and Figure 3—figure supplement 1B). These observations suggested that deletions of unstructured regions of IRE1LD could deregulate IRE1 activity.

Characterisation of IRE1LD deletion constructs in vivo and in vitro

To confirm the suggested role of deletions of the loop and the tail region of IRE1LD in deregulating its activity in cells, we reconstituted the endogenous Ern1 locus of the ∆IRE1 cell line with the most extensive IRE1 deletion variants identified above: the Δloop (missing residues 313–338), the Δtail (missing residues 391–444) or both (ΔΔ). The reconstituted alleles de-repressed IRE1 activity, as indicated by the elevated basal XBP1s::Turquoise signal (Figure 4A and Figure 4—figure supplement 1A). The IRE1 ΔΔ double deletion had the strongest deregulated phenotype under basal conditions. Like the shorter deletions, the IRE1 ΔΔ double deletion nonetheless retained some responsiveness to stress, albeit with a narrowed dynamic range (Figure 4A, compare untreated to tunicamycin-treated samples).

Figure 4 with 1 supplement see all
Cells expressing IRE1LD deletion variants exhibit a de-repressed IRE1 phenotype that correlates with less BiP bound to IRE1.

(A) Bar diagram of median XBP1::Turquoise and CHOP::GFP signals from untreated and tunicamycin (Tm)-treated CHO-K1 dual UPR reporter cells with Ern1 alleles encoding wild-type (wt) or the indicated deletion variants of IRE1 (∆loop, missing residues 313–338, ∆tail, missing residues 391–444, or ∆∆, missing both). Data from four independent experiments is shown [mean ± standard deviation (SD), **: p<0.01, ****: p<0.0001, one-way ANOVA with Sidak’s multiple comparison test] (Figure 4—source data 1). (B) Representative immunoblot (IB) of endogenously-expressed wt or the IRE1 ∆∆ deletion mutant (see ‘A’) and associated BiP recovered by immunoprecipitation (IP) of IRE1. BiP in input cell lysates is provided as a loading control. Quantification of the ratio of BiP to IRE1 signals after IP of three independent experiments is shown below (mean ± SD, *: p<0.05, ratio paired parametric Student’s t test) (see: Figure 4—source data 2) (C) Left panel shows a representative immunoblot of the indicated IRE1 variants with glutathione S-transferase (GST) replacing the cytosolic domain. The proteins were introduced into CHO-K1 cells by transient transfection, and the associated endogenous BiP recovered by glutathione pull down. BiP in input cell lysates is provided as a loading control. Quantification of the ratio of BiP to IRE1 signals in the IP of three independent experiments is shown to the right (mean ± SD, *: p<0.05, **: p<0.01, ***: p<0.001, one-way ANOVA with Sidak’s multiple comparison test).

To establish if the deregulating deletion affected the association of the IRE1LD with BiP, we compared the amount of BiP that co-immunoprecipitated with the endogenously expressed wild-type or IRE1 ΔΔ (Figure 4B). Despite variation in the total BiP signal intensity in the three independent repeats (Figure 4B, lower panel), paired analysis revealed that significantly less BiP was associated with the IRE1 ΔΔ mutant. The same was observed in a transient transfection system in which IRE1’s cytosolic effector domains were replaced with glutathione S-transferase (GST). Compared to the wild-type IRE1LD-GST bait, the amount of BiP recovered by glutathione affinity chromatography in association with the variants was significantly lower in context of the single deletions and even lower in case of the double-deletion IRE1LD ΔΔ-GST (Figure 4C).

Together, the observations described above confirm a role for the flexible regions of the IRE1LD in maintaining IRE1 in a repressed state in vivo and suggest that such repression may reflect a role for these flexible regions in specifying BiP binding. To follow up on this suggestion, Bio-Layer Interferometry (BLI) was used to compare BiP’s association with the biotinylated wild-type or double-deleted IRE1LD ∆∆ immobilised on the sensor. Immersing the sensor into a solution containing ERdj4, BiP and ATP gave rise to an association curve, that was reproducibly attenuated when IRE1LD ΔΔ was bound as a ligand compared to the wild-type IRE1LD (Figure 5—figure supplement 1A, left traces). A similar qualitative defect in BiP binding to IRE1LD ΔΔ was also observed when the full-length ERdj4 was replaced by its isolated J-domain (that lacks the regions required for specific targeting to the IRE1LD) (Figure 5—figure supplement 1A, right traces).

This last observation suggested that the defect in J-domain-mediated BiP binding to IRE1LD ΔΔ, had a component that was independent of recruitment of ERdj4 to IRE1LD by the former’s targeting domain and implied that the deleted region of IRE1LD had a role in specifying BiP association. This was explored further using J-IRE1LD fusion proteins as BLI ligands to enforce ATP hydrolysis by BiP in proximity to the wild-type or double-deleted IRE1LD (independent of the role these flexible regions of IRE1LD might have in J-domain co-chaperone recruitment). Immersing a BLI sensor loaded either with J-IRE1LD or J-IRE1LD ΔΔ into a solution containing BiP and ATP revealed a reproducible defect of BiP association to J-IRE1LD ΔΔ (Figure 5A left panel). No association was observed in presence of the substrate binding-deficient BiPV461F mutant. The dissociation in presence of ATP remained similar for both wild-type and J-IRE1LD ΔΔ (Figure 5A right panel), as expected of a process limited by BiP’s rate of nucleotide exchange.

Figure 5 with 1 supplement see all
Impaired BiP binding and monomerisation of IRE1LD ΔΔ in vitro.

(A) Left panel shows Bio-Layer Interferometry (BLI)-derived association (assoc.) and dissociation (dissoc.) traces of streptavidin sensors loaded with the indicated biotinylated ligands [a fusion of ERdj4’s J-domain to IRE1LD wild-type (wt) or ∆∆, as in Figure 1D] and exposed sequentially to the indicated solutions of analyte (containing wt BiP or the client-binding mutant BiPV461F). A representative experiment of three independent repetitions is shown. The traces were subtracted against a background derived from a BLI sensor with no ligand and the BLI signals (displacement) were set to zero after the first washing step. Quantification of the dissociation rate constants koff after association in presence of 0.15 µM BiP and 2 mM ATP are shown to the right. Traces were fitted to a two-phase dissociation function in Prism GraphPad 7.0. Shown are the mean ± standard deviation (SD) of three independent repetitions (n.s.: not significant, unpaired parametric Student’s t test). (B) Coomassie-stained SDS-PAGE gel of biotinylated wt IRE1LD (IRE1LD-bio), double deleted IRE1LD ∆∆ (IRE1LD ∆∆-bio) and BiP, recovered on a streptavidin matrix from samples constituted as indicated. 2 mM ATP was used during wash steps of the matrix when indicated. A representative data set is shown. Quantification of the ratio of BiP to IRE1 signals in the relevant samples after pull down from three independent experiments is shown on the right (mean ± SD, *: p<0.05, **: p<0.01, one-way ANOVA with Sidak’s multiple comparison test). (C) Time-dependent change in donor fluorescence of the indicated IRE1LD FRET pair incubated at t = 0 with the components shown to the right. The asterisks mark samples set up with a mock FRET sensor lacking the IRE1LD donor-labelled molecule. Protein concentrations were 0.2 µM FRET pair, 30 µM BiP, 2.5 µM full-length ERdj4 (or its isolated J-domain) and 2 mM ATP. A representative experiment of three independent repetitions is shown. When indicated, the data points were fitted to a one-phase association function in Prism GraphPad 7.0; the initial velocity represents the slope of the curve at time point zero (mean ± SD, ***: p<0.001, unpaired parametric Student’s t test) (see: Figure 5—source data 1).

The measurements above report on BiP’s interaction with the IRE1LD in the context of J-domain-mediated, ATP hydrolysis-driven ultra-affinity (Misselwitz et al., 1998; De Los Rios and Barducci, 2014). To examine the role of IRE1LD’s flexible regions in its affinity for BiP-ADP (an interaction that reports on a segment of the ultra-affinity cycle) we combined BiP with C-terminally biotinylated IRE1LD (either IRE1LD-bio or IRE1LD ∆∆-bio) in presence of ADP and absence of J-domain protein. Given the slow association of BiP-ADP with substrates and the slow dissociation of BiP oligomers a lengthy equilibration (16 hr) was allowed. Almost three-fold less BiP was recovered in complex with IRE1LD ∆∆-bio than with IRE1LD-bio (Figure 5B). BiP association was concentration-dependent, destabilised by ATP and was not observed with BiPV461F. Coupling of BiP’s two domains was dispensable for this interaction with IRE1LD-bio, as it was also observed with the domain-uncoupled BiPADDA (Preissler et al., 2015a). Together, these observations point to a role for the flexible regions of IRE1LD in specifying BiP association as a conventional substrate of this Hsp70. An additional role for the flexible regions in ERdj4 recruitment was not evident within the sensitivity of the tools available to us, and therefore remains unexcluded.

BiP binding in vitro promotes dissociation of the IRE1LD dimer (Amin-Wetzel et al., 2017 and Figure 1E). Therefore, we employed the same FRET-based assay to determine if impaired BiP binding affected monomerisation of IRE1LD ΔΔ -containing dimers. Wild-type fluorescent donor-labelled IRE1LD was allowed to dimerise with acceptor-labelled IRE1LD or IRE1LD ΔΔ and the rate at which BiP, ERdj4 and ATP promoted dissociation of these dimers was measured by following the increase in donor fluorescence over time. The initial velocity of BiP-mediated monomerisation of the IRE1LD ΔΔ containing heterodimers was considerably slower than monomerisation of wild-type homodimers (Figure 5C).

In BLI experiments, BiP association to monomeric IRE1LD P108A was faster than to the enforced dimeric IRE1LD Q105C SS (Figure 5—figure supplement 1B), raising the concern that both diminished BiP binding to the IRE1LD ΔΔ observed in BLI (Figure 5A) and the slower monomerisation of the IRE1LD ΔΔ containing FRET pair (Figure 5C) might reflect intrinsically enhanced stability of the IRE1LD ΔΔ-containing dimers. However, SEC of the purified proteins performed over a range of protein concentrations reported on similar affinities of the wild-type and IRE1LD ΔΔ dimers (Figure 5—figure supplement 1C and D) yielding K1/2 max values in the same order of magnitude as the KD of dimerisation measured by AUC (Zhou et al., 2006). Together, these observations suggest that diminished BiP binding to IRE1LD ΔΔ resulted in an impairment of BiP-driven IRE1LD monomerisation.

BiP-driven monomerisation of IRE1LD assessed by HX-MS

To complement the kinetic observations pointing to impaired BiP-driven monomerisation of IRE1LD ΔΔ with structural correlations, HX-MS was performed. To establish the HX-MS signature of monomerisation, deuteron incorporation was compared between wild-type and dimerisation-defective IRE1LD W125A or IRE1LD P108A mutants. This reported on monomerisation-induced deprotection of several peptic peptides from the IRE1LD (Figure 6A). Projecting these areas onto the crystal structure revealed that monomerisation affected HX at the dimer interface but also in parts further away (Figure 6B). IRE1LD monomerisation thus induced structural rearrangements across the protein. Moreover, the difference plot in HX reported on a gradation between both mutant variants, as IRE1LD P108A had an enhanced signature of monomerisation compared to IRE1LD W125A, matching the hierarchy of dimer instability observed by SEC and DSF analysis (Figure 2—figure supplement 1A and D, respectively).

Figure 6 with 1 supplement see all
BiP-mediated monomerisation of IRE1LD ∆∆ assessed by hydrogen exchange mass spectrometry (HX-MS).

(A) Difference plot of deuteron incorporation comparing wild-type (wt) IRE1LD with the monomeric mutants IRE1LD W125A (orange trace) or IRE1LD P108A (pink trace) after 30 s incubation in D2O [see Table 2 for the amino acid (aa) sequence of the individual segments]. Protein concentration was 5 µM. Shown are data from three independent experiments [mean ± standard deviation (SD)]. Boxes 1 and 2 highlight regions of greater hydrogen exchange (HX) in the monomeric mutants compared to wt IRE1LD that were analysed in presence of chaperones in ‘C’ (see Figure 6—source data 1). (B) Cartoon representation of the IRE1LD dimer (PDB: 2HZ6) coloured according to the difference of deuteron incorporation between wt and IRE1LD P108A after 30 s of incubation in D2O (from ‘A’). (C) Difference plot of the deuteron incorporation between the untreated sample and samples exposed to the indicated additives. The data for the same peptic peptides from wt IRE1LD and the IRE1LD ΔΔ mutant are displayed separately. Protein concentrations were 5 µM IRE1LD (wt or ∆∆ mutant), 30 µM BiP (wt or V461F mutant), 6 µM ERdj4 (wt or QPD mutant) and 2 mM ATP. Shown are the means ± SD of three data sets acquired after 30 s incubation in D2O (the corresponding 300 s data set is presented in Figure 6—figure supplement 1A and C) (see Figure 6—source data 2).

A similar deprotection signature, affecting most of the peptic peptides that are exposed upon monomerisation, was observed when IRE1LD was incubated with BiP and ERdj4 in presence of ATP (Figure 6C upper row, box 1: residues 77–128 and box 2: residues 280–302). Monomerisation was dependent on the integrity of all components of the reaction, as neither the substrate binding BiPV461F mutant nor the ERdj4QPD supported the pattern of deprotection observed in the monomeric versions of IRE1LD (the significance of the protection afforded by BiPV461F and ERdj4QPD to some peptides is presently unknown). IRE1LD ΔΔ exhibited delayed monomerisation in presence of BiP, ERdj4 and ATP: IRE1LD ΔΔ’s signature of monomerisation was absent after 30 s incubation in D2O (Figure 6C lower row) and was faint even after an exchange reaction of 300 s (Figure 6—figure supplement 1B and C lower row). In the absence of BiP, ERdj4 and ATP the difference plot comparing deuteron incorporation into IRE1LD and IRE1LD ΔΔ was negligible (Figure 6—figure supplement 1D) providing independent confirmation of the SEC measurements pointing to similar stability of the wild-type and IRE1LD ΔΔ mutant dimer (Figure 5—figure supplement 1C and D). Thus, HX-MS provided an orthogonal assay to the FRET-based measurement, reporting on BiP-mediated monomerisation of IRE1LD and a kinetic defect in this process brought about by deletion of flexible regions in the luminal domain that enforce IRE1’s repressed state in cells.

Close inspection of the HX-MS data revealed that some of the peptides (e.g. peptides 636.3802+ and 655.273+ corresponding to residues 96–106 and 297–302, respectively) exhibited clear bimodal isotope distribution. This characteristic is a signature for the EX1 exchange regime, indicative of the presence of two discrete subpopulations of molecules: a more folded and therefore low exchanging subpopulation and a more open, high exchanging subpopulation (Figure 7—figure supplement 1A and Materials and methods section). The contribution of low and high exchanging subpopulations to each isotope peak was determined by fitting the isotope peak maxima versus m/z data points (Figure 7A) to a two Gaussian distribution model (Hentze et al., 2016). From the fit parameters the fraction of each isotope peak that belongs to the low and high exchanging subpopulation was calculated [Figure 7—figure supplement 1A (blue and red parts of the bars) and 1B]. Comparison with the unexchanged and the 100% control samples revealed that the low exchanging subpopulation was largely protected from HX, whereas the high exchanging subpopulation had almost all amide protons exchanged for deuterons. Moreover, the low exchanging subpopulation converted into the high exchanging subpopulation with time (Figure 7—figure supplement 1A, compare 30 and 300 s incubation in D2O).

Figure 7 with 1 supplement see all
Analysis of bimodally-distributed isotope clusters of IRE1LD peptic peptides reveals active destabilisation of the IRE1LD dimer by BiP.

(A) Intensity distributions of the isotope clusters of peptide 655.273+ (residues 297–302) from IRE1LD, untreated or exposed to BiP, ERDj4 and ATP (30 min at 30°C) following different incubation times in D2O, as indicated. Curves are fits of the sum of two Gaussian distributions (Prism GraphPad 7.0, see Equation 4 in Materials and methods). A representative plot of three independent experiments is shown. (see: Figure 7—source data 1) (B) Plot of time-dependent change in the fractional contribution of high mass species to the isotope clusters of peptide 655.273+ (from ‘A’) calculated as described in Figure 7—figure supplement 1A and B. Shown are data points from three independent samples of IRE1LD in presence and absence of BiP, ERdj4 and ATP. The curves were fitted to a one-phase association model in Prism GraphPad 7.0. Data for a second informative peptide is shown in Figure 7—figure supplement 1C. (C) Bar diagram of the transition rate constant ktrans extracted by analysis of bimodal distributions in the isotope clusters of peptic fragments 636.3802+ and 655.273+ from IRE1LD in presence and absence of BiP, ERdj4 and ATP (from Figure 7B and Figure 7—figure supplement 1C). All the data points from three independent experiments are shown and the mean ± standard deviation (**: p<0.01, ****: p<0.0001, one-way ANOVA with Sidak’s multiple comparison test).

Interestingly, the degree of conversion into the high exchanging subpopulation was more pronounced for the IRE1LD P108A monomeric mutant than for wild-type IRE1LD and essentially complete after 300 s (Figure 7—figure supplement 1A left panel). SEC analysis of IRE1LD P108A showed that at 5 µM (the concentration at which the protein was diluted into D2O) it is mostly monomeric (Figure 2—figure supplement 1A). Hence, these data suggest that the conversion from the low exchanging subpopulation to the high exchanging subpopulation was a feature of the monomeric state.

HX is a quasi-irreversible reaction: Once a molecule has transiently assumed a high exchanging conformation (and undergone the exchange) the signature of having transited through a high exchanging conformation remains even if the protein is in a conformational equilibrium (and individual molecules transit back to the low exchanging conformation). Thus, HX-MS detects the transition to the high exchange endpoint. The observation that for wild-type IRE1LD the transition from the low (blue) to the high (red) exchanging population occurred with much slower kinetics than for IRE1LD P108A (Figure 7—figure supplement 1A, compare left panel, monomeric IRE1LD P108A with the right panel, wild-type IRE1LD) suggests that a higher proportion of IRE1LD monomers increased the transition rate, whereas the presence of IRE1LD dimers leads to a reduction of the rate constant. Hence, the extracted transition rate ktrans reports on IRE1LD’s monomer-dimer equilibrium during the reaction.

Next, we compared the ktrans of peptic peptide 655.273+ from wild-type IRE1LD in presence and absence of BiP, ERdj4 and ATP. Due to pre-incubation of the reactions, the three-protein system already had a higher proportion of monomeric IRE1LD at the point of dilution into D2O (reflected in a greater proportion of the high mass population at the earliest measurement). Nevertheless, an accelerated time-dependent increase in the proportion of monomeric IRE1LD was observed in the BiP-treated sample, indicating an increase in ktrans (Figure 7A and B). Acceleration of ktrans was also observed with peptide 636.3802+ in presence of BiP, ERdj4 and ATP (Figure 7C and Figure 7—figure supplement 1C).

Because it is affected by peptide-specific flexibility, ktrans itself is not a direct measure of the first order dissociation rate of the IRE1LD dimer (its koff), however, the difference observed in ktrans for any individual peptide measured under two conditions mainly reports on differences in IRE1LD dimer dissociation. Therefore, these findings imply that BiP-induced IRE1LD monomerisation has a component arising from active destabilisation of the dimer.

Discussion

The notion that a chaperone machinery with an Hsp70, such as BiP, as its terminal effector might negatively regulate activity of an upstream UPR transducer, such as IRE1, has the appeal of simplicity: Hsp70’s can potently affect the structure and function of their clients. The level of free BiP is kept low by inactivating oligomerisation and AMPylation and is further limited by client titration (Preissler and Ron, 2019). Therefore, the availability of a BiP-dependent machinery to serve as an active repressor of IRE1 is a plausible inverse measure of the level of ER stress. For years, the inverse relationship between the recovery of BiP in complex with IRE1 and exposure of cells to conditions causing ER stress has provided the only experimental support for this chaperone repression model (Bertolotti et al., 2000; Okamura et al., 2000; Oikawa et al., 2009). The recent establishment of an ATP- and co-chaperone-dependent system in which BiP promotes a pool of monomeric, inactive-state IRE1LD further supports the model by revealing BiP’s potential to affect a major change in IRE1’s activity in vitro (Amin-Wetzel et al., 2017). Here, we provide much needed further support for the chaperone repression model by demonstrating that directing endogenous BiP to bind endogenous IRE1LD as a substrate also attenuates signalling in cells, thus revealing BiP’s potential as a direct IRE1 repressor in vivo.

A structure-based targeted approach identified regions of IRE1LD that impart a repressed state in vivo. The same regions proved important for ATP and co-chaperone-dependent BiP-mediated conversion of active-state IRE1LD dimers to inactive-state monomers in vitro and their presence accelerated the formation of an ATP and co-chaperone-dependent complex with BiP in vitro. Monomerisation was observed in both a FRET-based assay, involving labelled molecules of IRE1LD, and in an HX-MS assay with intact molecules, thus establishing a firm correlation between the determinants of IRE1 that regulate its function in vivo and those that specify its regulation in vitro by a BiP-led machinery (Figure 8).

Cartoon depicting features of BiP-mediated regulation of IRE1 activity.

In stressed cells unfolded proteins compete for BiP, exposing IRE1LD to a default dimeric active state, specified by the kinetics of the monomer-dimer equilibrium (left panel). In compensated cells BiP (assisted by ERdj4 and possibly other J-domain proteins, not shown) binds flexible regions of IRE1LD. Engagement of these regions in the IRE1LD dimer may favor active dimer disassembly by entropic pulling or allosterically induced conformational changes (right panel). BiP binding to the same flexible regions of the IRE1LD monomer, may inactivate IRE1 by disfavoring re-dimerisation (right panel). The dynamic nature of BiP binding, which entails cycles for ATP hydrolysis-driven client engagement and nucleotide exchange-mediated release, ensures that IRE1 activity is kinetically coupled to the balance between unfolded protein load and folding capacity of the cell.

Correlation between factors involved in BiP regulation of IRE1 in vitro and UPR activity in vivo have been previously noted: Deregulated AMPylation of BiP activates IRE1 in cells (Preissler et al., 2015b) and BiP AMPylation in vitro blocks IRE1LD monomerisation (Amin-Wetzel et al., 2017). ERdj4 acts in concert with BiP to monomerise IRE1LDin vitro and loss of ERdj4 from cells de-represses IRE1 in vivo (Amin-Wetzel et al., 2017). However, genetic lesions in trans-acting ER-localised factors also have the potential to broadly alter the state of the ER and thereby unleash processes that affect IRE1 independently (of any direct interaction with BiP). Indirect effects are less likely a consequence when IRE1LD is modified in cis. Therefore, whilst it is impossible to rule out contributions from factors other than the BiP machinery to the deregulation of IRE1 that arises from deletion of the unstructured regions of its luminal domain, attenuation of BiP-mediated IRE1 repression in cells emerges as a parsimonious unifying explanation for the findings presented here.

It is further notable that there is nothing in our observations to speak against the possibility that extended regions of unfolded ER proteins serve as activating ligands of IRE1 by binding across the IRE1LD dimer interface and stabilising it (Karagöz et al., 2019). IRE1 signalling is triggered by an imbalance between unfolded proteins and BiP. The latter results in more potential ligands for IRE1 and fewer molecules of its client-free ATP bound BiP repressor (Bakunts et al., 2017; Vitale et al., 2019). Thus, the two proposed mechanisms for IRE1 activation, could well co-exist. However, our findings do raise questions regarding the strength of the experimental evidence supporting the current ideas how unfolded proteins may serve as activating ligands of IRE1. The evidence rests prominently on the activity of a peptide, MPZ-N, nominated as a model activating ligand of IRE1LD (Karagöz et al., 2017). Our findings do not support the notion that this peptide specifically engages the MHC-like groove traversing the dimer interface, as a disulphide, crystallographically proven to lie across this groove, thereby locking the helices in a ‘closed’ conformation, had no effect on the binding of MPZ-N to IRE1LD. Furthermore, MPZ-N binding to IRE1LD did not stabilise it thermodynamically, whereas the aforementioned disulphide, which mimics the proposed dimer-stabilising effect of a bound peptide, increased the melting temperature IRE1LD by 10 °C. Nor did MPZ-N promote a shift in the monomer-dimer equilibrium of IRE1LD as assessed by SEC. These concerns, along with the lack of crystallographic data supporting engagement of the groove by ligands, suggest the need for further experiments to test the role of unfolded proteins as direct IRE1 activators.

HX-MS analysis revealed neither an ERdj4-dependent nor BiP and ATP-dependent protection within IRE1LD to suggest their binding site. It has been proposed that ERdj4’s bacterial homolog, DnaJ, exploits mostly side chain interactions to bind clients, with a strong preference for aromatic residues (Rüdiger et al., 2001). Such interactions, were they to serve as the basis for IRE1LD recognition by ERdj4, would be only visible to HX-MS if they stabilised the underlying secondary structure. Given the conventional mode of BiP action on IRE1LD (ATP and co-chaperone-dependent and abolished by the BiPV461F mutation), one would expect protection of 4–5 hydrogen amides by IRE1LD engagement in the chaperone’s substrate-binding domain. However, partial occupancy of multiple sites may have diluted any HX-MS signature of BiP binding. This is supported by the observation that at the concentrations of ERdj4 and BiP used in the HX-MS assay, the FRET assay reported peak fluorescence of only ~40% of the unquenched donor (at the kinetically driven pseudo steady state plateau of the reaction, Figure 1E). Thus, the lack of a clear ATP- and ERdj4-dependent BiP binding signature is consistent with the dynamic nature of BiP’s interaction with IRE1LD. Interestingly, we observed an ATP-independent protection against deuteron incorporation within IRE1LD that was also evident in presence of the substrate binding-defective BiPV461F. This might reflect a non-conventional interaction of BiP’s nucleotide binding domain with IRE1LD, as proposed by the Ali lab (Kopp et al., 2018; Kopp et al., 2019). However, this protection is not correlated to the activity-state of IRE1LD and its significance thus remains to be established.

Mechanistically, BiP’s interaction with IRE1LD shares features with other situations in which Hsp70s bind to native clients thereby regulating their activity: DnaJ-directed, DnaK-mediated destabilisation of E. coli σ32 (Rodriguez et al., 2008), functional regulation of the glucocorticoid receptor (Kirschke et al., 2014), regulation of the activity of the tumour suppressor p53 (Boysen et al., 2019; Dahiya et al., 2019), Hsf1 regulated heat shock gene expression (Abravaya et al., 1992) and Hsc70-mediated destabilisation of clathrin coats (Sousa et al., 2016). All these have in common client destabilisation and likely initiate at unstructured regions of the substrate. Thus, it seems reasonable to suggest that an important aspect of BiP’s ability to affect the disposition of IRE1LD’s monomer-dimer equilibrium arises from its interaction with the flexible regions identified here.

Bimodal analysis of the HX-MS data suggested that ERdj4-directed BiP binding can accelerate dimer disassembly. This is consistent with the ability of the IRE1LD dimer to serve as a ligand for ERdj4 and BiP (here and Amin-Wetzel et al., 2017). While BiP binding to and stabilisation of IRE1LD monomers may also contribute to shifting the monomer-dimer equilibrium towards the former, the HX-MS experiment suggests an (additional) active role for BiP in dimer destabilisation. This may arise from a BiP-binding induced bias of the ensemble of IRE1LD dimers towards conformers preferentially populated in the monomer. A similar mechanism of conformational selection has been proposed for DnaK-mediated destabilisation of E. coli σ32 (Rodriguez et al., 2008). Such ‘allosteric’ action is consistent with the observation that monomerisation has effects on IRE1LD structure that are far removed from the dimer interface. Alternatively, BiP binding may destabilise the IRE1LD dimer by entropic pulling (De Los Rios et al., 2006), as has been suggested in Hsc70-mediated destabilisation of clathrin coats (Sousa et al., 2016) (Figure 8). The latter mechanism would be further favoured by assembly of BiP oligomers on the surface of the IRE1LD, a possibility consistent with the >1:1 stoichiometry of BiP:IRE1LD complexes observed in some experiments (Amin-Wetzel et al., 2017) (although the latter may also reflect multiple BiP binding sites).

As shown here, flexible regions of IRE1LD contribute measurably to its repression in cells and to BiP-driven monomerisation in vitro. This observation is consistent with the idea that these regions serve as initiation points for BiP binding to promote dimer disassembly via entropic pulling, allosterically induced conformational changes or both. Considerable redundancy seems built into the process, as the deregulated IRE1∆∆ allele retained a measure of stress responsiveness in cells and the IRE1LD ∆∆ dimer was still slowly undone in a BiP-dependent process in vitro. Such redundancy has been observed previously: in both yeast and human, IRE1 deletion of the tail region connecting the structured core of IRE1LD to the transmembrane domain partially deregulated IRE1, whilst retaining partial responsiveness to ER stress (Oikawa et al., 2007; Oikawa et al., 2009). Redundancy in the structural features of the IRE1LD dimer that render it a substrate for BiP-dependent disassembly and the non-equilibrium kinetic nature for BiP’s action could serve as the basis for a smoothly graded response to variation in the levels of ER stress.

Materials and methods

Key resources table
Reagent type
(species) or resource
DesignationSource or
reference
IdentifiersAdditional
information
Strain, strain background (Escherichia coli)BL21 C3013 E. coliNEBCat no: C3013I
Strain, strain background (Escherichia coli)Origami B(DE3) E. coliNovagen/MERCKCat no: 70837
AntibodyAnti-mouse IRE1α serum (rabbit polyclonal)Bertolotti et al., 2000NY200used at 1/1000
Antibodyanti-hamster BiP (chicken polyclonal)Avezov et al., 2013Anti-BiPused at 1/1000
AntibodyAnti-GST (polyclonal rabbit)Ron and Habener, 1992Anti-CHOPused at 1/1000
Cell line, (Cricetulus griseus)Clone S21 a derivative of RRID: CVCL_0214Sekine et al., 2016CHO-K1 S21CHO CHOP::GFP, XBP1s::Turquoise dual UPR reporter cell line
Cell line, (Cricetulus griseus)CHO-K1 S21 CHOP::GFP, XBP1s::Turquoise ∆LD 15Kono et al., 2017∆IRE1CHO CHOP::GFP, XBP1s::Turquoise dual UPR reporter, Ern1 null cell line
Cell line, (Cricetulus griseus)CHO-K1 S21 CHOP::GFP, XBP1s::Turquoise IRE1 wild-typeThis paperIRE1 wild-typeCHO CHOP::GFP, XBP1s::Turquoise dual UPR reporter, Ern1 null cell line reconstituted with IRE1 wild-type
Cell line, (Cricetulus griseus)CHO-K1 S21 CHOP::GFP, XBP1s::Turquoise IRE1 ∆∆This paperIRE1 ∆∆CHO CHOP::GFP, XBP1s::Turquoise dual UPR reporter, Ern1 null cell line reconstituted with IRE1 ∆∆ (missing residues 313–338 and 391–444)
Peptide, recombinant proteinMPZ-NKaragöz et al., 2017MPZ-N12-mer peptide (MPZ-N) derived from myelin protein zero
Peptide, recombinant proteinFAM-MPZ-NKaragöz et al., 2017FAM-MPZ-NFAM labelled 12-mer peptide (MPZ-N) derived from myelin protein zero
Software, algorithmPrismGraphPad
Software, algorithmFlowJo,LLC,
Software, algorithmData Analysis 4.1Bruker
Chemical compound, drugTunicamycinMelfordCat no: T2250
Chemical compound, drug2-DeoxyglucoseSigmaCat no: D6134
Chemical compound, drug4μ8cTocris BioscienceCat no: 4479
Chemical compound, drugDigitoninCalbiochemCat no: 300410
Chemical compound, drugBiotin-NHS esterSigmaCat no: H1759
Chemical compound, drugProtease inhibitorsSigma Aldrich (MERCK)S8830
Chemical compound, drugOregon Green-iodoacetic acidThermoFisherCat no: O6010
Chemical compound, drugTAMRA-maleimideSigmaCat no: 94506
Chemical compound, drugPhosphocreatineSigmaCat no: 10621714001
Chemical compound, drugCreatine kinaseSigmaCat no: C3755
Recombinant DNA reagenthaBiP_27–654_pQE10 (plasmid)Petrova et al., 2008UK173N-terminally His6-tagged hamster BiP
Recombinant DNA reagenthaBiP_27–654_V461F_pQE10 (plasmid)Petrova et al., 2008UK182N-terminally His6-tagged hamster BiP V461F
Recombinant DNA reagenthaBiP_27–654_ADDA_pQE10 (plasmid)Preissler et al., 2015aUK984N-terminally His6-tagged hamster BiP ADDA
Recombinant DNA reagentH6_Ulp1_pET28b (plasmid)This studyUK1249H6-tagged Ulp1
Recombinant DNA reagentpCEFL_mCherry_3XFLAG_C (plasmid)Sekine et al., 2016UK1314pCEFL with 3XFLAG_C tagged from mCherry-tagged plasmid
Recombinant DNA reagentBPPTSP_SubA_22–347_3XFLAG_KDEL_pUC57_Acc65I_based_pCEFL_mCherry (plasmid)This studyUK14523xFLAG-tagged SubA with KDEL on mCherry-tagged plasmid
Recombinant DNA reagentBPPTSP_SubA_22–347_S272A_3XFLAG_KDEL_pUC57_Acc65I_based_pCEFL_mCherry (plasmid)This studyUK14593xFLAG-tagged SubAS272Awith KDEL mCherry-tagged plasmid
Recombinant DNA reagenthIRE1_19–486_dC_GST_del3UTR _pCDNA3 (plasmid)Amin-Wetzel et al., 2017UK1703C-GST-tagged cysteine-free human IRE1
Recombinant DNA reagentCHO_IRE1_guideC15.1_pSpCas9(BB)−2A-mCherry (plasmid)Kono et al., 2017UK1903Cas9 and guide targeting IRE1 in CHO-K1 ∆LD clone 15 (mCherry-tagged)
Recombinant DNA reagentCHO_IRE1_hIRE1-LD_reptemp4_pCR-Blunt2-TOPO (plasmid)Kono et al., 2017UK1968Repair template for wild-type IRE1 reconstitution in CHO-K1 cells
Recombinant DNA reagentSmt3_cgERdj4_24–222_pET-21a (plasmid)Amin-Wetzel et al., 2017UK2012N-Smt3-tagged Chinese amster ERdj4 24–222
Recombinant DNA reagentSmt3_J4_domain_24–90_pET-21a (plasmid)Amin-Wetzel et al., 2017UK2041N-Smt3-tagged Chinese hamster ERdj4 24–90
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD∆C_24_444 (plasmid)This studyUK2042N-His6-Smt3-tagged wild-type human IRE1LD24–444
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD∆C_24_444 Q105C (plasmid)Amin-Wetzel et al., 2017UK2045N-His6-Smt3-tagged cysteine-free human IRE1LD Q105C24–444
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD∆C_24_444 R234C (plasmid)Amin-Wetzel et al., 2017UK2048N-His6-Smt3-tagged cysteine-free human IRE1LD24–444, R234C (FRET probe)
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD∆C_24_444 S112C (plasmid)Amin-Wetzel et al., 2017UK2076N-His6-Smt3-tagged cysteine-free human IRE1LD24–444, S112C (FRET probe)
Recombinant DNA reagentSmt3_cgERdj4_24–222_GS6_MalE_pET21a (plasmid)Amin-Wetzel et al., 2017UK2108N-Smt3-ERdj4-MBP Chinese hamster 24–222
Recombinant DNA reagentSmt3_cgERdj4_24–222_QPD_GS6_MalE_pET21a (plasmid)Amin-Wetzel et al., 2017UK2119N-Smt3-ERdj4-MBP Chinese hamster residues 24–222 H54Q
Recombinant DNA reagentIRE1a_LD_∆C_24–443_AviTag_H6_pET30a (plasmid)This studyUK2246C-Avi-His6-tagged cysteine-free human IRE1LD24–444
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD∆C_Q105C_24_390 (plasmid)This studyUK2304N-His6-Smt3-tagged cysteine-free human IRE1LD Q105C24–390
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD_dC_24_390_∆313–338_S112C (plasmid)This studyUK2370N-His6-Smt3-tagged cysteine-free human IRE1LD ∆∆ (313-338, 391-444) S112C, FRET probe
Recombinant DNA reagentCHO_IRE1_hIRE1-LD_d313-338_reptemp4_pCR-Blunt2-TOPO (plasmid)This studyUK2384Repair template for IRE1 ∆loop (d313-338) reconstitution in CHO-K1 cells
Recombinant DNA reagentCHO_IRE1_hIRE1-LD_d391-444_reptemp4_pCR-Blunt2-TOPO (plasmid)This studyUK2385Repair template for IRE1 ∆tail (d391-444) reconstitution in CHO-K1 cells
Recombinant DNA reagentCHO_IRE1_hIRE1-LD_d313-338_d391-440_reptemp4_pCR-Blunt2-TOPO (plasmid)This studyUK2386Repair template for IRE1 ∆∆ (d313-338, 391–444) reconstitution in CHO-K1 cells
Recombinant DNA reagenthIRE1α_19–486_dC_ d313-338_d391-440_GST_del3UTR _pCDNA3 (plasmid)This studyUK2401C-GST-tagged cysteine-free human IRE1 ∆∆ (missing residues 313–338 and 391–444)
Recombinant DNA reagenthIRE1α_19–486_dC_ d313-338_GST_del3UTR _pCDNA3 (plasmid)This studyUK2404C-GST-tagged cysteine-free human IRE1 ∆loop (missing residues 313–338)
Recombinant DNA reagenthIRE1α_19–486_dC_ d391-440_GST_del3UTR _pCDNA3 (plasmid)This studyUK2406C-GST-tagged cysteine-free human IRE1 ∆∆ (missing residues 391–444)
Recombinant DNA reagentMet_ERdj4_24–120_Ire1a_LD∆C_24–443_AviTag_H6_pET30a (plasmid)This studyUK2408C-Avi-His6-tagged cysteine-free chimeric J-ERdj4 human IRE1LD24–444 protein
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD_dC_24_444_P108A (plasmid)This studyUK2410N-His6-Smt3-tagged cysteine-free human IRE1LD P108Amonomeric mutant 24–444
Recombinant DNA reagentpET22b_H7_Smt3_Ire1a_LD_dC_24_444_W125A (plasmid)This studyUK2411N-His6-Smt3-tagged cysteine-free human IRE1LD W125Amonomeric mutant 24–444
Recombinant DNA reagentMet_ERdj4_24–120_Ire1a_LD∆C_24–443_S112C_AviTag_H6_pET30a (plasmid)This studyUK2412C-Avi-His6-tagged cysteine-free chimeric J-ERdj4 human IRE1LD24–444 protein, S112C (FRET probe)
Recombinant DNA reagentJ4_WT_IRE1_LD_CHORepairTemplate (plasmid)This studyUK2425Repair template for chimeric J-IRE1 reconstitution in CHO-K1 cells
Recombinant DNA reagentJ4_QPD_IRE1_LD_CHORepairTemplate_V1 (plasmid)This studyUK2426Repair template for chimeric JQPD-IRE1 reconstitution in CHO-K1 cells
Recombinant DNA reagentMet_ERdJ4_24–120_Ire1a_LD∆C_24–443_P108A_AviTag_H6_pET30a (plasmid)This studyUK2428C-Avi-His6-tagged cysteine-free chimeric J-ERdj4 human IRE1LD24–444 protein containing monomerising mutation P108A
Recombinant DNA reagentMet_ErdJ4_24–120_IRE1a_LD∆C_24–390_∆313–338_AviTag_H6_pET30a (plasmid)This studyUK2458C-Avi-His6-tagged cysteine-free chimeric J-ERdj4 human IRE1LD ∆∆protein (313-338, 391-444)
Recombinant DNA reagentIRE1a_LD∆C_24–390_∆313–338_AviTag_H6_pET30a (plasmid)This studyUK2459C-Avi-His6-tagged cysteine-free human IRE1LD ∆∆(d313-338, 391–444)
Recombinant DNA reagentMet_ERdJ4_24–120_Ire1a_LD∆C_24–443_Q105C_AviTag_H6_pET30a (plasmid)This studyUK2558C-Avi-His6-tagged cysteine-free chimeric J-ERdj4 human IRE1LD24–444 protein containing mutation Q105C

Mammalian cell culture

Request a detailed protocol

The parental strains for the CRISPR-Cas9-mediated homologous recombination approaches were the previously described ΔLD15 dual CHOP::GFP and XBP1s::Turquoise UPR reporter Chinese Hamster Ovary CHO-K1 cell lines (Kono et al., 2017) and have been authenticated as CHO-K1 using the criteria of successful targeting of essential genes using a species-specific CRISPR whole genome library, and sequencing of the wild-type or mutant alleles of the genes studied that confirmed the sequence reported for the corresponding genome. The cell lines have tested negative for mycoplasma contamination using a commercial kit (MycoAlert (TM) Mycoplasma Detection Kit, Lonza). None of the cell lines is on the list of commonly misidentified cell lines maintained by the International Cell Line Authentication Committee. The CRISPR-Cas9-mediated mutagenesis strategy and the transient transfection of GST-tagged IRE1LD was performed with CHO-K1 S21 dual UPR reporter cells (Sekine et al., 2016). Cells were cultured in Ham’s nutrient mixture F12 (Sigma). All cell media was supplemented with 10% (v/v) serum (FetalClone-2, Hyclone), 2 mM L-glutamine (Sigma), 100 U/ml penicillin and 100 μg/ml streptomycin (Sigma). Cells were grown in tissue culture dishes or multi-well plates (Corning) at 37°C and 5% CO2. Tunicamycin (Melford) treatment was at 2.5 μg/ml for 16 hr, 2-Deoxyglucose (2DG) (Sigma) treatment at 4 mM for 16 hr and 4μ8c (Cross et al., 2012) treatment at 10 μM for 7 days. The drugs were mixed with pre-warmed culture medium and immediately added to the cells by medium exchange.

Transfection

Request a detailed protocol

Cells were transfected using Lipofectamine LTX (Life Technologies) transfection reagent with reduced serum medium Opti-MEM (Life Technologies) following the manufacturer’s instructions.

Flow cytometry and fluorescence-activated cell sorting (FACS)

Request a detailed protocol

To analyse the effect of IRE1 variants expressed from the endogenous Ern1 locus on the UPR (Figure 1A and B, Figure 4—figure supplement 1A and B), flow cytometry was performed. Cells were washed once in PBS and collected in PBS containing 4 mM EDTA. Single-cell fluorescent signals (20,000/sample) were analysed by dual-channel flow cytometry with an LSRFortessa cell analyser (BD Biosciences). FACS was performed on either a Beckman Coulter MoFlo or a BD FACSMelody cell sorter. Cells were washed once in PBS and then incubated 5 min in PBS supplemented with 0.5% BSA and 4 mM EDTA before sorting into fresh media. CHOP::GFP fluorescence was detected with excitation laser at 488 nm, filter 530/30 nm; XBP1s::Turquoise fluorescence with excitation laser 405 nm, filter 450/50 nm and mCherry fluorescence with excitation laser 561, filter 610/20. To generate clonal cell lines stably expressing a version of IRE1 the transfected cells were treated with 2-Deoxyglucose to gate for cells showing high CHOP::GFP XBP1s::Turquoise fluorescence.

Gene manipulation and allele analysis

Request a detailed protocol

Cas9 guides were either manually designed following standard guidelines (Ran et al., 2013) or taken from the CRISPy database (URL: http://staff.biosustain.dtu.dk/laeb/crispy/, (Ronda et al., 2014). Cells were transfected with the Cas9 and guide constructs and grown for seven days before they were analysed by flow cytometry or FACS.

For the in vivo mutagenesis strategy (Figure 3B and C and Figure 3—figure supplement 1B), a series of guides that tiled the two regions of interest, set A covering the putative loop (residues 308–362) and set B covering the tail (residues 368–444) was designed. Set A and set B guide-Cas9 encoding plasmids were transfected singly or in different pairwise combinations into IRE1 wild-type expressing cells (CHO-K1 S21 CHOP::GFP, XBP1s::Turquoise dual reporter cell line) and pooled to create population 0 (Figure 3C). Rare de-repressing IRE1 mutants were enriched from the mutagenised population by iterative rounds of FACS (populations 1 and 2) followed by a selection against clones that had acquired IRE1-independent XBP1s::Turquoise reporter expression, as assessed by their unresponsiveness to the IRE1 inhibitor 4µ8c. Genomic DNA was extracted from final clones, PCR used to amplify the loci of interest and the resultant products were sequenced. The genomic DNA was extracted from cells by incubation in Proteinase K solution (100 mM Tris-HCl pH 8.5, 5 mM EDTA, 200 mM NaCl, 0.25% SDS, 0.2 mg/ml Proteinase K) overnight at 50 °C. Next, Proteinase K was heat inactivated at 98 °C for 20 min before the supernatant was collected and used as a template in PCR reactions before sequencing. To facilitate the interpretation of the sequencing data, the changes in size of alleles modified by Cas9 was determined by capillary electrophoresis on a 3730xl DNA analyser (Applied Biosystems). For that, sample preparation was performed with one of the oligonucleotides having a 5’ 6-carboxyfluorescein (FAM) flurophore in the PCR reaction.

Creating clonal cell lines stably expressing IRE1 variants

Request a detailed protocol

The activity of IRE1 variants was analysed by introducing them into the endogenous Ern1 locus of CHO-K1 CHOP::GFP and XBP1s::Turquoise dual UPR reporter cells using a Ern1 null cell line (∆IRE1 as described in Kono et al., 2017). Cells were transfected with a Cas9-CRISPR guide construct targeting the Ern1 locus (UK1903) together with the respective repair templates (UK2425 for chimeric J-IRE1, UK2426 for JQPD-IRE1, UK1968 for wild-type IRE1, UK2384 for IRE1 ∆loop, UK2385 for IRE1 ∆tail, UK2386 for IRE1 ∆∆) and grown for 7 days before further analysis. Cells that successfully repaired the IRE1 locus were selected by FACS by gating for cells exhibiting increased XBP1s::Turquoise fluorescence after 2-deoxyglucose treatment. Cells transfected with J-IRE1 as repair template were additionally transiently transfected with a plasmid encoding SubA wild-type, mutant or an empty vector (UK1452, UK1459, UK1314 respectively) before FACS. Data shown in Figure 4A and Figure 4—figure supplement 1A was acquired after transient transfection using a mixed population of cells and data shown in Figures 1A, B, C and 4B and Figure 4—figure supplement 1B with clonal cell lines.

Mammalian cell lysis

Request a detailed protocol

Cell lysis was performed as described previously (Amin-Wetzel et al., 2017). All reagents were kept on ice throughout. Cells were washed in PBS, removed from the culture dish in PBS + 1 mM EDTA with a cell scraper and then pelleted at 370 × g for 5 min at 4°C. Cells were incubated in lysis buffer (1% Triton X-100, 150 mM NaCl, 20 mM HEPES-KOH pH 7.5, 10% glycerol, 1 mM phenylmethylsulphonyl fluoride (PMSF), 4 μg/m Aprotinin, 2 μg/ml Pepstatin A and 2 μM Leupeptin) for 5 min. Next, the samples were clarified at 21,130 g for 10 min at 4°C. The supernatant was transferred to a fresh tube and protein concentration measured with BioRad protein assay reagent (Bio-Rad).

For BiP co-IP experiments, non-specific binding of BiP to protein-A sepharose beads was decreased by digitonin treatment (Le Gall et al., 2004) to remove non-membrane associated BiP from cells prior to lysis. After pelleting, cells were washed in HNC buffer (50 mM HEPES-KOH pH 7.5, 150 mM NaCl, 2 mM CaCl2) and then incubated in HNC + 0.1% (w/v) digitonin (Calbiochem) for 10 min. Cells were then washed in HNE buffer (50 mM HEPES-KOH pH 7.5, 150 mM NaCl, 1 mM EGTA) before proceeding to lysis using lysis buffer supplemented with 10 mM MgCl2, 6 mg/ml glucose and 50 U/ml Hexokinase (H4502 Sigma) to deplete ATP and stabilise BiP-substrate interactions.

Immunoprecipitation (IP) and GST pull down assays

Request a detailed protocol

To analyse the amount of BiP co-immunoprecipitated with endogenously expressed IRE1 variants (Figures 1C and 4B) or transiently transfected IRE1LD-GST variants (Figure 4C), Protein A sepharose 4B beads (Zymed Invitrogen) or Glutathione (GSH) Sepharose 4B beads (GE Healthcare) were equilibrated in lysis buffer. Next, 20 μl beads per sample and anti-IRE1α were added to lysates and left rotating for 1 hr at 4°C. The beads were then washed in lysis buffer and residual liquid removed using a syringe. The protein from the beads was eluted in SDS sample buffer containing 20 mM DTT.

Antibodies

Anti-mouse IRE1α serum (NY200) was used for IP and immunoblot detection of endogenous IRE1α (Bertolotti et al., 2000). An anti-hamster BiP antibody was used for immunoblot detection of endogenous BiP (Avezov et al., 2013). Anti-GST serum was used for immunoblot detection of GST fusion proteins (Ron and Habener, 1992).

Reducing/non-reducing SDS-PAGE and immunoblotting

Request a detailed protocol

Samples were run on standard polyacrylamide Tris-HCl gels and transferred to Immobilon-P PVDF membrane (Pore size 0.45 μm, Sigma). Membranes were then blocked in 5% (w/v) dried skimmed milk in PBS, washed in TBS with 0.1% Tween-20 and exposed to various primary antibodies/antisera followed by incubation with IRDye fluorescently labelled secondary antibodies. Imaging was carried out with using a LICOR CLx Odyssey infrared imager. Coomassie-staining was carried out with Instant Blue (Expedeon). Signal quantitation from SDS-PAGE gels or from immunoblots was carried out using the ImageJ software (NIH).

Protein purification

Human IRE1LD

Request a detailed protocol

His6-Smt3-IRE1LD (UK2048, UK2079, UK2042, UK2370, UK2410, UK2411, UK2516, UK2045, UK2304) and His6-Avitag-IRE1LD (UK2412, UK2246, UK2459, UK2408, UK2458) variants were encoded on a pET-derived vector (Novagen) as fusion proteins and expressed in T7 Express lysY/Iq E. coli cells (NEB). IRE1LD Q105C variants (UK2045, UK2304) used to make disulphide-linked dimeric IRE1LD Q105C species were expressed in Origami B(DE3) cells (Novagen).

Protein purification was performed as described in Amin-Wetzel et al. (2017). Bacterial cultures were grown at 37°C in LB medium containing 100 mg/ml ampicillin until an OD600nm of 0.6–0.8 was reached. Expression was induced with 0.5 mM IPTG and the cells were incubated for 16 hr at 18°C. After sedimentation of the cells by centrifugation the pellets were resuspended in TNGM buffer (50 mM Tris-HCl pH 7.4, 500 mM NaCl, 10% glycerol, 1 mM MgCl2). The cell suspension was supplemented with 0.1 mg/ml DNaseI and protease inhibitors (2 mM PMSF, 4 mg/ml Pepstatin, 4 mg/ml Leupeptin, 8 mg/ml Aprotinin) and lysed by repeated passage through a high-pressure homogenizer (EmulsiFlex-C3, Avestin). After clarification of the lysates by centrifugation at 20,000 × g for 30 min the supernatant was removed and incubated for 60 min at 4°C with Ni-NTA agarose (Qiagen) (0.5 ml per liter of bacterial culture). The matrix was washed two times with 50 ml of TNGMI wash buffer (50 mM Tris-HCl pH 7.4, 500 mM NaCl, 10% glycerol, 1 mM MgCl2, 20 mM imidazole). The matrix was transferred to a gravity-flow column and the flow-through was collected after a wash with one bed volume of elution buffer (50 mM Tris-HCl pH 7.4, 100 mM NaCl, 10% glycerol, 250 mM imidazole). The protein solutions were concentrated using 30 kDa MWCO centrifugal filters (Amicon Ultra; Merck Millipore), flash frozen and stored at −80 °C.

For the preparation of UK2042, UK2045, UK2410, UK2411 and UK2516 1.5 µg/ml His6-Ulp1 (UK1249) and 1 mM TCEP were added to the eluates and incubated overnight at 4°C, whilst being dialysed against HKM buffer (50 mM HEPES-KOH pH 7.4, 150 mM KCl, 10 mM MgCl2). To remove the cleaved His6-Smt3-tag and the His6-Ulp1 the solution was again incubated with Ni-NTA agarose for 60 min at 4°C. After passing the sample through a gravity-flow column the final eluate was collected, concentrated using 30 kDa MWCO centrifugal filters, flash frozen and stored at −80 °C.

For the preparation of UK2304, the dialysis overnight was performed against TN buffer (150 mM NaCl, 50 mM Tris-HCl pH 7.4). After removal of uncleaved protein and His6-Smt3 the protein solution was then diluted to 75 mM NaCl, 50 mM Tris-HCl pH 7.4, 10 mM imidazole and bound to an anion exchange column. The protein was eluted in 10 mM Tris-HCl pH 7.4 50–500 mM NaCl and then incubated with 5 mM oxidised glutathione overnight. The sample was then separated on a Superdex 200 10/300 GL gel filtration column equilibrated in TN buffer and appropriate fractions collected and concentrated using 30 kDa MWCO centrifugal filters, flash frozen and stored at −80 °C.

The purification of the FRET probes (UK2048, UK2076, UK2412, UK2370) was performed as described above with 1 mM TCEP contained in all buffers. Eluted fractions were buffer exchanged into HKMT buffer (50 mM HEPES-KOH pH 7.4, 150 mM KCl, 10 mM MgCl2, 1 mM TCEP) using a CentiPure P10 desalting column (Generon) and labelled with threefold molar excess of Oregon Green-iodoacetic acid (ThermoFisher) or TAMRA-maleimide (Sigma) to make IRE1LD R234C-OG (UK2048), IRE1LD R112C-TMR (UK2076), J-IRE1S112C-TMR (UK2412) and IRE1LD ∆∆ S112C-TMR (UK2370). The reaction proceeded at room temperature in the dark overnight and was quenched by the addition of 5 mM DTT. The reaction mixture was passed through a CentiPure P10 gravity-desalting column (Generon) equilibrated in HKM buffer and afterwards through a Superdex 200 10/300 GL gel filtration column equilibrated in HKG (50 mM HEPES-KOH pH 7.4, 150 mM KCl, 10% (v/v) glycerol) buffer. Appropriate fractions were collected, concentrated, flash frozen and stored at −80 °C.

For the streptavidin pull down (Figure 1D and Figure 5B) and the Bio-Layer Interferometry (BLI) measurements (Figure 5A and Figure 5—figure supplement 1A and B), chimeric J-IRE1LD (UK2408), J-IRE1LD ∆∆ (UK2458), J-IRE1LD P108A (UK2428) and J-IRE1LD Q105C SS(UK2558), wild-type IRE1LD (UK2246) and IRE1LD ∆∆ (UK2459) were biotinylated enzymatically with E. coli BirA to create biotinylated J-IRE1LD-bio and IRE1LD-bio variants, respectively.

Hamster ERdj4

Request a detailed protocol

Expression and purification of ERdj4 and variants was performed according to the protocol previously described in Amin-Wetzel et al. (2017). The constructs were expressed as fusion proteins with an N-terminal His6-Smt3 (UK2012 for wild-type ERdj4) or with both, an N-terminal His6-Smt3 and C-terminal MBP (UK2108 for wild-type and UK2119 for QPD ERdj4) in Origami B(DE3) cells. Cells were grown and lysed as described above for His6-Smt3 tagged proteins. Ni-NTA chromatography was performed as described above. His6-Smt3-ERdj4-MBP variants were further purified on a S200 10/300 GL column equilibrated in HKM buffer.

Hamster BiP

Request a detailed protocol

BiP and BiP variants (UK173, UK182, UK984) were purified as previously described in Petrova et al. (2008); Preissler et al. (2015a).

Streptavidin pull down assays

Request a detailed protocol

To assess BiP binding to IRE1LD variants in the presence and absence of J-domain-mediated hyper-affinity (Figure 1D and Figure 5B, respectively), 20 μl Dynabeads MyOne Streptavidin C1 (Thermo Fisher Scientific) per sample were used. Analysis was performed in HKMGTw buffer (50 mM HEPES-KOH pH 7.4, 150 mM KCl, 10 mM MgCl2, 10% (v/v) glycerol, 0.05% TWEEN-20). Reactions contained 5 μM biotinylated IRE1LD proteins (UK2246, UK2408, UK2459), 8 μM ERdj4 (UK2012), 30 μM BiP variants (UK173, UK182, UK984), and 2 mM ATP. In experiments conducted in presence of a J-domain the samples were incubated for 20 min at 30°C. In experiment conducted in absence of a J-domain for 16 hr at 4°C. Next, the samples were clarified at 21,130 × g for 5 min and an excess of ice cold 1 mM ADP was added to the supernatant followed by the addition of Dynabeads. Binding was performed for 45 min at 4°C followed by washing in assay buffer supplemented with 1 mM ADP (for the ATP wash 2 mM ATP was used instead). The samples were eluted with 1x SDS sample buffer.

Analytical size-exclusion chromatography (SEC)

Request a detailed protocol

To assess the oligomeric state of wild-type IRE1LD (UK2042), IRE1LD W125A (UK2411) and IRE1LD P108A (UK2410) and IRE1LD ∆∆ (UK2516) in presence and absence of MPZ-N peptide (GeneScript, Piscataway, NJ), SEC was performed (Figure 2A and B, Figure 2—figure supplement 1A and Figure 5—figure supplement 1C). Samples were run through a SEC-3 HPLC column (300 Å pore size; Agilent Technologies) on an Agilent infinity HPLC system equilibrated in HKM buffer at a flow rate of 0.3 ml/min. Samples were pre-incubated in a final volume of 20 µl for 30 min at 30°C before clarification at 21,130 × g for 5 min and subsequent injection of 10 µl. Runs were performed at 25°C and A280 absorbance and TAMRA (TMR, excitation 544 nm and emission 572 nm) traces were recorded.

Bio-layer interferometry (BLI) experiments

Request a detailed protocol

Experiments were performed on an Octet RED96 (Pall ForteBio) in HKM buffer supplemented with 0.05% Triton X-100. In the sequential dipping experiments (Figure 5A and Figure 5—figure supplement 1A and B), streptavidin biosensors were loaded with the indicated biotinylated IRE1LD variants (UK2246, UK2428, UK2558, UK2459, UK2408, UK2458) to approximately 1 nm displacement, washed in assay buffer, and then sequentially dipped in wells containing the indicated analytes. For the two-component system (Figure 5A and Figure 5—figure supplement 1B) with the chimeric J-IRE1LD fusions 0.15 or 0.5 µM BiP wild-type (UK173), 0.5 µM BiPV461F (UK182) and 2 mM ATP were used and for the three-protein system (Figure 5—figure supplement 1A) 2 µM BiP (UK172), 6.8 µM ERdj4 full-length (UK2012) or J-domain (UK2041) and 2 mM ATP. After each association, the sensor was dipped into buffer containing 2 mM ATP to allow for BiP dissociation. Data were normalised to the signal after the first wash step.

Kinetic FRET experiments

Request a detailed protocol

To assess the effect of a fused J-domain to IRE1LD (Figure 1E) or the introduction of deletions into the IRE1LD on Erdj4 and BiP-mediated monomerisation (Figure 5C) kinetic FRET measurements were performed. For this, heterodimeric FRET pairs consisting of an OG-labelled wild-type donor molecule combined with a TMR-labelled mutant acceptor molecule were employed. Although this experimental setup reduces the dynamic range of the measurements, it is compensated by the greater comparability of detecting changes in donor fluorescence in presence of a constant IRE1LD-OG donor molecule. IRE1LD-OG donor (UK2048-OG) and IRE1LD-TMR acceptor (UK2076-TMR, UK2412-TMR, or UK2370-TMR) molecules were combined at a 1:2 ratio and incubated at room temperature in the dark for two hours. In Figure 1E 30 µM BiP, 2.5 µM ERdj4 (UK2108), and 0.2 µM IRE1LD-FRET pair were combined in HKMGTw buffer and incubated for 30 min. To initiate the reaction, 2 mM ATP with an ATP regeneration system (8 mM phosphocreatine, 0.016 mg/ml creatine kinase) was added. In Figure 5C, 30 µM BiP, 2.5 µM ERdj4 full-length (UK2108) or J-ERdj4 (UK2041), and 0.2 µM pre-equilibrated IRE1LD-FRET pair were combined in HKMGTw buffer. The donor fluorescence was followed with a CLARIOstar plate reader (excitation: 470–15 nm, emission: 524–20 nm) recording signals every 30 s. The donor fluorescence was background subtracted arising from a well containing buffer only and analysed with the Prism GraphPad 7.0 software.

Differential scanning fluorimetry (DSF)

Request a detailed protocol

DSF experiments were performed on a CFX96 Real-Time System (Bio-Rad). Reactions were transferred into 96-well qPCR plates (Thermofisher) (final volume 25 µl). Protein concentrations were 5 µM, ligands at the concentration indicated in the figure (62.5–1000 µM), and SYPRO Orange (Thermofisher) dye at a 10x concentration in HKM buffer. Where indicated 1 mM TCEP was included. Over a temperature range of 20–95°C fluorescence of the SYPRO Orange dye was monitored using the SYBR-FAM filter set. Data was then analysed in Prism GraphPad 7.0, with melting temperature calculated as the global minimum of the negative first derivative of the respective fluorescent unit melt curves. Data shown in Figure 2—figure supplement 1D indicate a correlation between the monomer-dimer equilibrium and the Tm of IRE1LD. In line with that, titrational analysis of IRE1LD and variants reported on an increased Tm at higher protein concentrations, however it did not result in a two state transition representing the monomer and the dimer because of oligomerisation (data not shown). Moreover, the lower Tm of the monomeric variants could reflect an intrinsic destabilisation of the protein caused by the point mutation.

Fluorescence polarisation (FP)

Request a detailed protocol

To characterise the binding of FAM labelled MPZ-N peptide [5-FAM-LIRYCWLRRQAA) (as described in Karagöz et al. (2017), from GeneScript, Piscatawy, NJ] to IRE1LD or disulphide-linked IRE1LD Q105C SS. (Figure 2D). FP was measured with a CLARIOstar plate reader. Using excitation at 496 nm and measuring emission at 519–550 nm, parallel and perpendicular fluorescence of the FAM fluorophore was detected. Whilst FAM-MPZN was kept at 100 nM in reactions the concentrations of IRE1LD variants are detailed in the legend of Figure 2D. Samples containing the respective components were prepared in 25 μl and then 20 μl were transferred to a black flat-bottomed 384 well plate and incubated for 30 min prior to reading. Fluorescence readings were corrected by subtracting fluorescence from a well containing only buffer. The average of three readings (spaced at 30 s intervals) per well was taken as one repeat and the average of three independent repeats was used for Figure 2D. Anisotropy was calculated according to Equation 1:

(1) A=Ipara-IperpIpara+2Iperp

The data was fit to Equation 2:

(2) rfree+(rmax-rfree)hXh+Kh

whereby rfree represents anisotropy in the absence of protein, rmax the theoretical maximal anisotropy, [X] the protein concentration and h the hill-coefficient. Curve fitting was per- formed with Prism GraphPad 7.0 and minimal constraints to obtain K1/2max values with Rvalues > 0.9. As this equation does not consider the equilibria between IRE1LD dimers and oligomers, the K1/2max value does not reflect the dissociation constant.

Hydrogen exchange mass spectrometry (HX-MS)

Request a detailed protocol

For Figure 6A and Figure 6—figure supplement 1A, 5 µM wild-type IRE1LD (UK2042) or monomeric IRE1LD W125A (UK2411) and IRE1LD P108A (UK2410) were pre-incubated for 30 min at 30 °C in HKM buffer. The samples were then diluted 1:20 in D2O buffer supplemented with 10 mM ADP (HKM buffer was lyophilised and re-dissolved in pure D2O at least three times) and incubated for 30 and 300 s at 30°C. Deuterated samples were quenched 1:1 with ice-cold quench buffer (2% formic acid), immediately subjected to LC-MS using an Agilent UPLC and a MaXis mass spectrometer (Bruker). For each experiment at least one unexchanged sample and one fully deuterated control were measured. The unexchanged protein sample was diluted 1:20 in H2O buffer. The fully deuterated sample (protein in HKM buffer containing 6 M guanidine hydrochloride, lyophilised and re-dissolved in pure D2O at least three times) was treated as the other samples. For HX-MS experiments presented in Figure 6C, Figure 6—figure supplements 1B, C, 5 µM wild-type IRE1LD (UK2042) or IRE1LD ∆∆ (UK2516) was incubated with 30 µM BiP wild-type (UK173) or V461F mutant (UK182), 6 µM ERdj4 wild-type (UK2108) or ERdj4 QPD mutant (UK2119) and 2 mM ATP in HKM buffer. Dilution in D2O buffer and subsequent steps were performed as described above. Data analysis was performed manually (Data Analysis 4.1, Bruker).

HX-MS data analysis of the bimodal distributed isotope clusters

Request a detailed protocol

In order to observe an amide hydrogen exchange, a structure-specific H-bond between a peptide backbone amide hydrogen and an H-bond acceptor has to open. This opening occurs by unfolding of secondary structures within the native conformation of the protein according to Equation 3:

(3) F(H)kclkopU(H)OD/D2OkchU(D)kopkclF(D)

Hereby, F and U indicate the folded and unfolded state of the structural element, respectively. The conversions between these conformations are determined by kop and kcl, representing the opening and closing rate constants. The intrinsic chemical exchange rate is indicated by kch.

There are two extreme cases, distinguishing the so-called EX1 and EX2 exchange regimes. In case of EX1 kcl is much smaller than kch. Therefore, all amide protons exchange at once upon unfolding and the observed rate is practically equal to the opening rate kop of the structural element. This type of exchange kinetics is characterised by a bimodal distribution of the isotope peaks in peptic mass spectra showing two separate, interconverting subpopulations (Figure 7—figure supplement 1A). Notably, the EX1 exchange regime occurs only rarely under native conditions and is more likely to be observed in presence of chemical denaturants as they decrease the closing rate kcl without affecting the intrinsic chemical exchange rate kch by interfering with H-bond and hydrophobic core formation. EX2 is most commonly observed, as under native state conditions kcl is generally much greater than the intrinsic chemical exchange rate kch. Hence, many opening and closing cycles are necessary in order to exchange all amide protons to deuterons, which is visible by a gradual increase of the average mass in the peptic mass spectra whilst the isotopic distribution remains roughly the same (Rist et al., 2003). By comparing IRE1LD with the monomeric variants we identified regions exhibiting increased deuteron incorporation in the monomeric state of the protein, with some of them revealing bimodal distributions of the isotope clusters. In order to calculate the contribution of each subpopulation to the peak intensities, an equation for two Gaussian distributions was fitted to the isotope peak maxima versus m/z plots using the Prism GraphPad 7.0 software:

(4) I=A1σ2πe12(μμ1σ)2+A2σ2πe12(μμ2σ)2

Hereby, A1/2 represents the area of the two peaks; µ, the m/z values; µ-, the means of the Gaussian distributions, representing the centroid of each of the two subpopulations; and σ, the standard deviation of the Gaussian distributions, corresponding to the width of the isotope peak distribution. For each peptide exhibiting a bimodal distribution all intensity values belonging to one incubation time in D2O were globally fitted assuming that σ and µ1/2 are constant. Independent experiments were treated independently. Next, the fitted parameters A1/2, µ1/2 and σ were used to calculate the proportion of the low and high mass subpopulation for each individual isotope peak.

Crystallisation, data collection and structure determination

Request a detailed protocol

Initial crystals were obtained by screening commercial crystallisation plates via 200 nl protein (16 mg/ml) plus 200 nl well solution in 96-well sitting drop plates at 20°C. The best diffraction dataset was collected from a crystal grown in 9% MPD, 0.1 M HEPES-KOH pH 7.5 microseeded (D'Arcy et al., 2007) from diluted initial crystals in 20% MPD, 0.1 M HEPES-KOH pH 7.5. Crystals were briefly soaked into 9% MPD, 0.1 M HEPES-KOH pH 7.5, 25% (v/v) glycerol and cryocooled in liquid nitrogen. Diffraction data was collected at beamline I04-1 in the Diamond Synchrotron Light Source (DLS) and processed by the XIA2 pipeline (Winter, 2010) implementing Dials (Winter et al., 2018) for indexing and integration, Pointless for space group determination, and Aimless for scaling and merging (Evans, 2011). The structure was solved by searching the published IRE1LD core structure (PDB 2HZ6) using Phaser (McCoy et al., 2007). One molecule of IRE1 was found in one asymmetric unit, but the electron density around Cys105 and the SG-SG bond length suggested that Cys105 formed a disulphide bond with the symmetric Cys105. Further refinement was performed iteratively using COOT (Emsley et al., 2010) and refmac5 (Winn et al., 2001) (Table 1) in CCP4i2 interface (Potterton et al., 2018) and phenix.refine (Liebschner et al., 2019). MolProbity (Chen et al., 2010) was consulted throughout the refinement process. Molecular graphics were generated with PyMOL Molecular Graphics System, Educational-use-only version 4.5 Schrodinger, LLC).

Data availability

Diffraction data have been deposited in PDB under the accession code 6SHC. All data generated or analysed during this study are included in the manuscript and supporting files. Source data files have been provided for Figures 1–7.

The following data sets were generated
    1. Yan Y
    2. Amin-Wetzel N
    3. Ron D
    (2019) RCSB Protein Data Bank
    ID 6SHC. Crystal structure of human IRE1 luminal domain Q105C.

References

    1. Emsley P
    2. Lohkamp B
    3. Scott WG
    4. Cowtan K
    (2010) Features and development of coot
    Acta Crystallographica. Section D, Biological Crystallography 66:486–501.
    https://doi.org/10.1107/S0907444910007493
    1. Wall D
    2. Zylicz M
    3. Georgopoulos C
    (1994)
    The NH2-terminal 108 amino acids of the Escherichia coli DnaJ protein stimulate the ATPase activity of DnaK and are sufficient for lambda replication
    The Journal of Biological Chemistry 269:5446–5451.

Article and author information

Author details

  1. Niko Amin-Wetzel

    Cambridge Institute for Medical Research (CIMR), University of Cambridge, Cambridge, United Kingdom
    Present address
    Institute of Science and Technology Austria (IST Austria), Klosterneuburg, Austria
    Contribution
    Conceptualization, Data curation, Validation, Visualization, Methodology
    Contributed equally with
    Lisa Neidhardt
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-4640-3724
  2. Lisa Neidhardt

    Cambridge Institute for Medical Research (CIMR), University of Cambridge, Cambridge, United Kingdom
    Contribution
    Data curation, Formal analysis, Validation, Visualization
    Contributed equally with
    Niko Amin-Wetzel
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0003-0256-5040
  3. Yahui Yan

    Cambridge Institute for Medical Research (CIMR), University of Cambridge, Cambridge, United Kingdom
    Contribution
    Data curation, Visualization
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0001-6934-9874
  4. Matthias P Mayer

    Center for Molecular Biology of Heidelberg University (ZMBH), DKFZ-ZMBH Alliance, Heidelberg, Germany
    Contribution
    Formal analysis, Supervision
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-7859-3112
  5. David Ron

    Cambridge Institute for Medical Research (CIMR), University of Cambridge, Cambridge, United Kingdom
    Contribution
    Conceptualization, Supervision, Funding acquisition, Methodology, Project administration
    For correspondence
    dr360@medschl.cam.ac.uk
    Competing interests
    Senior editor, eLife
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-3014-5636

Funding

Medical Research Council

  • Niko Amin-Wetzel

European Molecular Biology Organization

  • Lisa Neidhardt

Deutsche Forschungsgemeinschaft (SFB1036 TP9)

  • Matthias P Mayer

Wellcome (Wellcome 996 100140)

  • David Ron

Wellcome (Wellcome 200848/Z/16/Z)

  • David Ron

Deutsche Forschungsgemeinschaft (MA 1278/4-3)

  • Matthias P Mayer

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.

Acknowledgements

We thank the CIMR flow cytometry core facility team (Reiner Schulte, Chiara Cossetti and Gabriela Grondys-Kotarba) for assistance with FACS, the Huntington lab for access to the Octet machine, Steffen Preissler for advice on data interpretation, Roman Kityk and Nicole Luebbehusen for help and advice with HX-MS experiments.

Copyright

© 2019, Amin-Wetzel et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.

Metrics

  • 3,865
    views
  • 650
    downloads
  • 59
    citations

Views, downloads and citations are aggregated across all versions of this paper published by eLife.

Citations by DOI

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Downloads (link to download the article as PDF)

Open citations (links to open the citations from this article in various online reference manager services)

Cite this article (links to download the citations from this article in formats compatible with various reference manager tools)

  1. Niko Amin-Wetzel
  2. Lisa Neidhardt
  3. Yahui Yan
  4. Matthias P Mayer
  5. David Ron
(2019)
Unstructured regions in IRE1α specify BiP-mediated destabilisation of the luminal domain dimer and repression of the UPR
eLife 8:e50793.
https://doi.org/10.7554/eLife.50793

Share this article

https://doi.org/10.7554/eLife.50793