1. Neuroscience
Download icon

CCR5 is a suppressor for cortical plasticity and hippocampal learning and memory

  1. Miou Zhou
  2. Stuart Greenhill
  3. Shan Huang
  4. Tawnie K Silva
  5. Yoshitake Sano
  6. Shumin Wu
  7. Ying Cai
  8. Yoshiko Nagaoka
  9. Megha Sehgal
  10. Denise J Cai
  11. Yong-Seok Lee
  12. Kevin Fox  Is a corresponding author
  13. Alcino J Silva  Is a corresponding author
  1. University of California, Los Angeles, United States
  2. Cardiff University, United Kingdom
  3. Aston University, United Kingdom
  4. Tokyo University of Science, Japan
  5. Seoul National University College of Medicine, Republic of Korea
Research Article
  • Cited 4
  • Views 1,650
  • Annotations
Cite as: eLife 2016;5:e20985 doi: 10.7554/eLife.20985


Although the role of CCR5 in immunity and in HIV infection has been studied widely, its role in neuronal plasticity, learning and memory is not understood. Here, we report that decreasing the function of CCR5 increases MAPK/CREB signaling, long-term potentiation (LTP), and hippocampus-dependent memory in mice, while neuronal CCR5 overexpression caused memory deficits. Decreasing CCR5 function in mouse barrel cortex also resulted in enhanced spike timing dependent plasticity and consequently, dramatically accelerated experience-dependent plasticity. These results suggest that CCR5 is a powerful suppressor for plasticity and memory, and CCR5 over-activation by viral proteins may contribute to HIV-associated cognitive deficits. Consistent with this hypothesis, the HIV V3 peptide caused LTP, signaling and memory deficits that were prevented by Ccr5 knockout or knockdown. Overall, our results demonstrate that CCR5 plays an important role in neuroplasticity, learning and memory, and indicate that CCR5 has a role in the cognitive deficits caused by HIV.



C-C chemokine receptor 5 (CCR5) is a seven-transmembrane G protein-coupled receptor (GPCR) involved in recruiting leukocytes to sites of tissue damage during inflammatory responses. CCR5 is highly expressed in T cells and macrophages in the immune system (Sorce et al., 2011). In the central nervous system, CCR5 is expressed in microglia, astrocytes and neurons in multiple brain regions (Cartier et al., 2005; Meucci et al., 1998; Tran et al., 2007; Westmoreland et al., 2002), including the CA1 region of the hippocampus (Torres-Muñoz et al., 2004).

Ligand binding to CCR5 is known to modulate several parallel signaling cascades implicated in learning and memory, including the suppression of adenylyl cyclase (AC), as well as the activation of the PI3K/AKT and p44/42 MAPK signaling (Cartier et al., 2005; Paruch et al., 2007; Tyner et al., 2005). The CCR5 endogenous ligand RANTES (also known as CCL5) is reported to block neuronal [Ca2+]i oscillations (Meucci et al., 1998) and to modulate glutamate release (Musante et al., 2008), suggesting a role for CCR5 in the regulation of neuronal function.

CCR5 has a key role in HIV infection by mediating virus cellular entry. Ccr5 knockdown inhibits HIV-1 infection in macrophages (Liang et al., 2010) and CCR5 antagonists effectively reduce HIV-1 expression in AIDS patients (Hunt and Romanelli, 2009). Treatment with the CCR5 antagonist maraviroc has been reported to improve neurocognitive test performance among patients with moderate cognitive impairment (Ndhlovu et al., 2014), supposedly by reducing monocytes and inflammation. Cognitive deficits affect approximately 30% of HIV-positive adults and 50% of HIV-positive infants (Galicia et al., 2002), and are a significant clinical problem associated with HIV infection. Although CCR5 plays a crucial role in HIV infection in the central nervous system (CNS) (Ellis et al., 2007Zhou and Saksena, 2013), little is known about its role in neuronal plasticity or learning and memory, or whether this receptor plays a direct role in HIV-associated cognitive disorders.

Here, we demonstrate that manipulations that decrease CCR5 function result in elevated MAPK and CREB levels during learning, enhance synaptic plasticity and improve both cortical sensory plasticity and hippocampal learning and memory, while the transgenic overexpression of this receptor causes learning and memory deficits. Thus, our studies reveal an important suppressor role for CCR5 in neuroplasticity, learning and memory, independent of the proposed roles of CCR5 in neuroinflammation and neurodegeneration. Since our results and other studies (Cormier and Dragic, 2002; Morikis et al., 2007; Shen et al., 2000) show that HIV coat proteins can bind and activate CCR5, thus activating its memory suppressor functions, our results suggest that besides the neuroinflammation induced neurodegeneration that can cause HIV-associated cognitive deficits, CCR5 activation by HIV coat proteins also contributes to the cognitive deficits caused by HIV.


Identification of Ccr5 knockout mice in a reverse genetic memory screen

Our first indication that CCR5 was involved in plasticity and memory came from a reverse genetic memory screen. In total, 148 transgenic and knockout mutant mouse strains with controlled genetic backgrounds were chosen at random from the inventories of commercial vendors (Jackson Laboratories and Taconic Farms) as well as individual laboratories, and screened for contextual memory phenotypes (Figure 1—figure supplement 1 and Figure 1—source data 1). Interestingly, 6 out of the 8 chemokine or chemokine receptor mutant strains screened (# labeling, Figure 1—figure supplement 1) showed positive Z scores (see Materials and methods), including three mutant strains with scores above 1, suggesting enhanced memory for contextual conditioning. HRasG12V mice were used for comparison, since they were previously reported (Kushner et al., 2005) to show enhanced memory for contextual fear conditioning. Like HRasG12V mice, mice homozygous for a null-mutation of the Ccr5 gene (Ccr5-/-) showed average Z scores above 1. The CCR5 knockout resulted in memory enhancements for contextual conditioning when tested 24 hr after training (Figure 1—figure supplement 2A, t(14) = 2.43 p<0.05, Student’s t-test) and 2-weeks after training (Figure 1—figure supplement 2B, t(14) = 3.07 p<0.01, Student’s t-test). These results show that the Ccr5 knockout results in enhanced long-term (24 hr) and remote (2-weeks) memory. Importantly, activity levels including baseline activity and activity bursts during shock-exposure were normal (Figure 1—figure supplement 2C,D), a result demonstrating that the enhanced freezing of Ccr5-/- mice is not due to either decreases in activity or increased sensitivity to the unconditioning stimulus (i.e., the footshock). In contrast to contextual conditioning, tone conditioning (Hall et al., 2001) was unaltered in the Ccr5-/- mice (Figure 1—figure supplement 2E), confirming that the contextual conditioning enhancement of these mutants is not due to non-specific behavioral changes that alter conditioning responses.

Ccr5+/- mice show enhanced memory in multiple memory tasks

To test whether the heterozygous deletion mutation (Ccr5+/-) also results in enhanced memory, Ccr5+/- mice were trained in the contextual fear conditioning task and were tested 2-weeks after training. Compared to WT littermates, Ccr5+/- mice showed increased freezing levels (Figure 1A, t(20) = 2.37 p<0.05, Student’s t-test); in contrast, baseline activity and shock sensitivity were normal in these mutants (Figure 1—figure supplement 3A), demonstrating that both the Ccr5 heterozygous and homozygous mutations result in enhanced contextual memory.

Figure 1 with 4 supplements see all
Ccr5+/- mice show enhanced memory in multiple memory tasks.

(A) In a fear conditioning test given two weeks after training, Ccr5+/- mice showed enhanced contextual memory (WT n = 11, Ccr5+/- n = 11; *p<0.05, Student’s t-test). (B) In a water maze probe test given after two days of training, Ccr5+/- mice spent significantly more time in the target quadrant than in the other three quadrants of the water maze. In contrast, WT mice did not search selectively for the platform (WT n = 14, Ccr5+/- n = 16; *p<0.05, Two-way ANOVA with repeated measure). Heat maps below the bar graphs show the combined traces of the mice from each group during the probe test. (C) There was no difference between WT mice and Ccr5+/- mice in social training. In the social recognition test given 24 hr after training (7 min, a training time chosen to undertrain WT mice), Ccr5+/- mice, but not WT mice, spent more time exploring the novel OVX mouse (WT n = 14, Ccr5+/- n = 19; **p<0.01, one sample t-test compared to 50%). Error bars indicate SEM.


To determine whether the Ccr5+/- mutation also affects other forms of hippocampal-dependent memory (Kogan et al., 2000; Riedel et al., 1999), the mice were tested in the Morris water maze and social recognition tasks. In the hidden-platform version of the Morris water maze, mice were tested for their ability to use spatial cues around a pool to find an escape platform hidden just beneath the water surface. Following 2-days of training, memory was assessed by a probe test wherein the mice search for 60 s with the platform removed from the pool. Since this probe test was administered early in training, the WT mice did not search selectively for the platform. In contrast, even with this limited amount of training, Ccr5+/- mice spent significantly more time in the quadrant where the platform had been during training (target quadrant) than the other three quadrants, demonstrating that the Ccr5+/- mutation not only enhances learning and memory for contextual conditioning, but also results in enhanced spatial learning and memory [Figure 1B; Two-way ANOVA with repeated measure, overall (genotype × percentage of time in each quadrant) interaction: F(3,84) = 0.81; Main effect of quadrant%: F(3,84) = 6.99. Between the target quadrant and all other quadrants for Ccr5+/- mice: p<0.05, Bonferroni post-tests]. Heat maps, derived from the combined swimming traces of the mice in each group during the probe test, also illustrate the spatial learning and memory enhancement of Ccr5+/- mice (Figure 1B).

The social recognition task takes advantage of mice’s preference for novel stimuli and tests their ability to distinguish familiar versus novel conspecifics (Kogan et al., 2000). For this task, mice were first habituated to the testing chamber on day 1; on day 2, they were placed in the same chamber and allowed to interact for 7 min with an ovariectomized (OVX) female mouse placed under a wired cylinder (training session). On day 3, individual mice were placed back into the same chamber (test session), and allowed to interact with two OVX females (one familiar and one novel) (Figure 1C). In the test session, compared to WT mice, Ccr5+/- mice spent significantly more time exploring the novel OVX mouse, indicating that the Ccr5+/- mutation also enhanced learning and memory in the social recognition test (Figure 1C, t(18) = 3.39 p<0.01, one sample paired t-test compared to 50%). Importantly, the Ccr5+/- mutation did not affect the total interaction time during training, demonstrating that their learning and memory enhancement is not due to increased social interaction.

Since anxiety and activity levels could confound the results of the memory tests described above, we tested the Ccr5+/- mice and their WT littermate controls in the elevated plus maze and open field tasks. Ccr5+/- mice were similar to WT littermates in both open arm entries and percentage time spent in the open arms of the elevated plus-maze, two well-known measures of anxiety (Figure 1—figure supplement 3B); Analyses of the open field (e.g., measures of total distance traveled and percentage time in center zone) also revealed no differences between the Ccr5+/- mice and their WT controls (Figure 1—figure supplement 3C). A previous study reported that CCR5 deficiency results in the activation of astrocytes, which leads to neurodegeneration in aged mice (Lee et al., 2009). We measured astrocyte numbers and apoptosis with GFAP and TUNEL staining in the hippocampus of 3-month old mice, and found that in our genetic background there is no difference between WT and Ccr5+/- mice (Figure 1—figure supplement 4A–C). Measurements of spine density in the hippocampal CA1 subregion revealed no differences between YFP/WT and YFP/Ccr5+/- mice (Figure 1—figure supplement 4D). Altogether, these results indicate that the learning and memory enhancements of the Ccr5+/- mice are not confounded by abnormal anxiety, changes in locomotor activity, astrogliosis, apoptosis, or spine density.

Enhanced MAPK and CREB signaling and long-term potentiation in Ccr5+/- mice

Mitogen-activated protein kinases p44/42 (MAPKs) (Atkins et al., 1998; Kushner et al., 2005; Schafe et al., 2000) and cAMP-responsive element-binding protein (CREB) (Bourtchuladze et al., 1994; Dash et al., 1990; Yin et al., 1994) are known to have a central role in hippocampal learning and memory and in cortical plasticity (Barth et al., 2000; Glazewski et al., 1999). We focused our signaling studies at two different time points (1 hr and 3 hr) following training (Chwang et al., 2006; Stanciu et al., 2001). Prior to learning (measurements in home cage controls), there were no differences between WT and Ccr5+/- mice in either hippocampal MAPK or CREB activation measured with phospho-specific antibodies (Figure 2A). In contrast, Ccr5+/- mice showed enhanced phosphorylated MAPK (Figure 2B, t(10) = 4.45 p<0.01, Student’s t-test) and enhanced phosphorylated CREB levels (Figure 2C, t(12) = 2.21 p<0.05, Student’s t-test) at 1 and 3 hr after fear conditioning, respectively (see Figure 2—figure supplements 1, 2 and 3 for MAPK and CREB levels at both 1 hr and 3 hr).

Figure 2 with 3 supplements see all
Ccr5+/- mice show post-training increases in MAPK and CREB signaling and enhanced hippocampal LTP.

(A) Hippocampus collected from home cage WT and Ccr5+/- mice had similar levels of phosphorylated p44/42 MAPK and CREB (MAPK: WT n = 4, Ccr5+/- n = 4; CREB: WT n = 6, Ccr5+/- n = 7). (B) Ccr5+/- mice showed enhanced levels of phosphorylated p44/42 MAPK (normalized with total MAPK) in hippocampal samples collected one hour after fear conditioning training (WT n = 6, Ccr5+/- n = 6; **p<0.01, Student’s t-test). (C) Ccr5+/- mice showed enhanced levels of phosphorylated CREB (normalized with total CREB) in hippocampal samples collected 3 hr after fear conditioning training (WT n = 7, Ccr5+/- n = 7; *p<0.05, Student’s t-test). (D) CA1 fEPSPs were recorded in hippocampal slices before (baseline) and after 5 TBS (theta bursts stimulation, each burst consists of four stimuli at 100 Hz, 200 ms inter-burst interval). Ccr5+/- slices show a significant LTP enhancement in the fEPSP measured during the last 10 min of recordings following the tetanus (n = 7 mice for both WT and Ccr5+/-; *p<0.05, Student’s t-test). Error bars indicate SEM.


Since MAPK/CREB signaling in neurons is known to affect synaptic plasticity, we tested whether the Ccr5+/- mice show enhanced long-term potentiation (LTP), a cellular mechanism underlying learning and memory (Bliss and Collingridge, 1993; Lee and Silva, 2009). Field EPSPs (fEPSPs) evoked by Schaffer collateral stimulation were recorded in the CA1 region of acute hippocampal slices prepared from WT and Ccr5+/- mice. Analyses of the fEPSPs between 50 and 60 min post-tetanus revealed enhanced LTP in Ccr5+/- mice (Figure 2D, t(12) = 2.61 p<0.05, Student’s t-test). Our results suggest that the enhancement in MAPK/CREB signaling causes the hippocampal enhancements in LTP that likely underlies the hippocampal-dependent learning and memory enhancements of Ccr5+/- mice. More importantly, these signaling, electrophysiological and behavioral results of Ccr5+/- mice suggest that CCR5 is a plasticity and memory suppressor (Abel et al., 1998).

Knockdown of Ccr5 in adult hippocampus results in enhanced memory

The Ccr5 knockout we studied is neither restricted to the hippocampus nor specific to adult brain neurons, leaving open a number of other alternative explanations for the results described above. Therefore, we used Adeno-Associated Viral vectors (AAV5) to restrict a shRNA-mediated Ccr5 knockdown to the adult hippocampus. AAV5 vectors containing either shRNA-CCR5 or shRNA-dsRed (shRNA-Cont) (Figure 3A) were injected into the hippocampal pyramidal fields of 3 month-old C57BL/6N mice. One month after shRNA-CCR5 virus injection, Ccr5 mRNA was markedly reduced in the hippocampus compared to shRNA-Cont virus (Figure 3B, t(7) = 7.54 p<0.001, Student’s t-test). Similarly, in cultured HEK293 cells, infection of shRNA-CCR5, but not shRNA-Cont reduced Ccr5 expression (Figure 3—figure supplement 1A). Additionally, one-month after shRNA-Cont or shRNA-CCR5 AAV injection, GFP expression (indicating AAV transfection) was observed widely in the hippocampal pyramidal fields (including CA1 and CA2) of both groups (Figure 3C). Most GFP-positive cells were recognized by the NeuN antibody (neuronal marker), but not by the Iba1 antibody (microglia marker) (Figure 3D and Figure 3—figure supplement 1B) or the GFAP antibody (astrocyte marker) (Figure 3—figure supplement 1C), demonstrating that the viral vectors we used mainly transfected neurons, a result that we also confirmed in the barrel cortex (see results below).

Figure 3 with 1 supplement see all
Ccr5 knockdown in the adult hippocampus results in enhanced memory.

(A) Schematics of the shRNA-CCR5 and shRNA-dsRed (shRNA-Cont) plasmids. (B) AAV containing shRNA-CCR5 or shRNA-Cont was injected into the hippocampus CA1/CA2 region, and dorsal CA1/CA2 Ccr5 mRNA was measured one-month after virus injection. Compared to shRNA-Cont, shRNA-CCR5 triggered a significant reduction in Ccr5 mRNA expression (***p<0.001, student’s t-test). Also, Ccr5-/- mice showed no Ccr5 mRNA expression in hippocampus. (C) AAV containing shRNA-CCR5 or shRNA-Cont was injected into the hippocampus. One month after virus injection, brain slices were stained with DAPI (nuclear labeling) and GFP (virus infection). Scale bar, 500 μm. (D) AAV containing shRNA-CCR5 or shRNA-Cont was injected into the hippocampus. One month after virus injection, brain slices were stained with GFP (virus infection), NeuN (neurons), and Iba1 (microglia). GFP was exclusively expressed in neurons. Scale bar, 20 μm. (E) AAV containing shRNA-CCR5 or shRNA-Cont was injected into the hippocampus, and mice were subjected to behavioral testing one month after virus injection. In the fear conditioning test, shRNA-CCR5 mice showed enhanced contextual memory when compared to those injected with shRNA-Cont virus (shRNA-cont n = 7, shRNA-CCR5 n = 10; **p<0.01, Student’s t-test). (F) In the probe test given after two days of water maze training, only shRNA-CCR5 mice but not shRNA-Cont mice spent significantly more time in the target quadrant than the other three quadrants (shRNA-cont n = 22; shRNA-CCR5 n = 20; *p<0.05, Student’s t-test; ***p<0.001, Two-way ANOVA with repeated measure). Heat maps below the bar graphs show the combined traces of the mice from each group during the probe test. shRNA-Cont mice showed a pattern of wall-hugging swim after two days training, but they learned the water maze task with extended training (Figure 3—figure supplement 1D). Error bars indicate SEM.


To test the impact of Ccr5 knockdown in hippocampal pyramidal fields, we trained the transfected mice with contextual fear conditioning one-month after virus injection. When tested 2-weeks after training, the shRNA-CCR5 mice showed enhanced contextual memory compared to shRNA-Cont mice (Figure 3E, t(15) = 3.46 p<0.01, Student’s t-test). Mice transfected with shRNA-CCR5 showed similar enhancements in spatial learning and memory in the Morris water maze. Specifically, we utilized the paradigm used for our knockout studies where a probe test was given after 2 days training, when most control mice (transfected with shRNA-Cont virus) still failed to learn the task (e.g., spent similar times in all four quadrants of the maze). Strikingly, mice transfected with the shRNA-CCR5 virus spent significantly more time in the target quadrant than the other three quadrants [Figure 3F; Two-way ANOVA with repeated measure, overall (virus × percentage of time in each quadrant) interaction: F(3,120) = 4.18; Main effect of quadrant%: F(3,120) = 9.45. Between the target quadrant and all other quadrants for shRNA-CCR5 mice: p<0.001, Bonferroni post-tests; Target quadrant percentage between shRNA-Cont and shRNA-CCR5 group: t(40) = 2.53 p<0.05, Student’s t-test]. Similar results were also obtained for other measures of probe trial performance including proximity to the target platform and platform crossings (data not shown). Heat maps, derived from the combined swimming traces of the mice in each group during the probe test, also illustrate the spatial learning and memory enhancement of the shRNA-CCR5 group (Figure 3F). To test whether with more extended training shRNA-Cont mice could also learn the water maze task, a second probe test was given after 5 days of training. In this probe test, both shRNA-Cont and shRNA-CCR5 mice spent more time in the target quadrant (Figure 3—figure supplement 1D), demonstrating that with additional training the shRNA-Cont mice are able to show spatial learning in the water maze task.

Altogether, these results demonstrate that CCR5 is a memory suppressor and that knocking-down Ccr5 specifically in the adult CA1/CA2 is sufficient to enhance hippocampus-dependent learning and memory.

CCR5 overexpression leads to learning and memory deficits

Our CCR5 knockout and knockdown results demonstrate that CCR5 is a plasticity and memory suppressor, and therefore predict that increases in CCR5 function lead to memory deficits. To test this hypothesis, we generated transgenic (Tg) mice overexpressing Ccr5 under the Camk2a promoter (Mayford et al., 1996). Compared to WT mice, CCR5 Tg mice show increases in hippocampal Ccr5 mRNA expression (Figure 4A). To test the impact of CCR5 overexpression on learning and memory, WT and CCR5 Tg mice were tested in three hippocampal-dependent learning tasks, including two contextual fear conditioning paradigms that are sensitive to changes in hippocampal function (Cui et al., 2008; Matus-Amat et al., 2004). Analyses of a context pre-exposure fear-conditioning paradigm (Matus-Amat et al., 2004) demonstrated that CCR5 Tg mice showed robust memory deficits (Figure 4B, t(26) = 3.71 p=0.001, Student’s t-test). Similar results were also obtained with a multi-day fear conditioning training procedure (Figure 4—figure supplement 1A).

Figure 4 with 3 supplements see all
CCR5 overexpression leads to learning and memory deficits.

(A) Compared to WT mice, CCR5-overexpressing transgenic (Tg) mice showed enhanced Ccr5 mRNA expression in the hippocampus. (B) In a context pre-exposure fear-conditioning paradigm, CCR5 Tg mice showed contextual memory deficits compared to WT mice (WT n = 13, CCR5 Tg n = 15; ***p<0.001, Student’s t-test). (C) In the probe test given after 3 days of training in water maze, only WT mice but not CCR5 Tg mice, spent significantly more time in the target quadrant than the other three quadrants; CCR5 Tg mice also had lower searching times in the target quadrant than WT mice, indicating a learning and memory deficit (WT n = 18, CCR5 Tg n = 18; *p<0.05, Student’s t-test; ***p<0.001, Bonferroni post-tests, Two-way ANOVA with repeated measure). Error bars indicate SEM.


WT and CCR5 Tg mice were also trained in the Morris water maze, and probe tests were given after 3 days of training. In the probe test only WT mice, but not CCR5 Tg mice spent more time in the target quadrant than the other three quadrants [Figure 4C, Two-way ANOVA with repeated measure, Overall (genotype × quadrant%) interaction: F(3,102) = 3.42; Main effect of quadrant%: F(3,102) = 21.44; Between the target quadrant and all other quadrants for WT mice: ***p<0.001, Bonferroni post-tests; Target quadrant percentage between WT and Ccr5 transgenic group: t(34) = 2.33 *p<0.05, Student’s t-test]. CCR5 Tg mice also had higher average proximity from the platform and less target platform crossing compared to WT mice (Figure 4—figure supplement 1B), indicating that CCR5 overexpression results in spatial memory deficits. When a second probe test was given after extended training, both WT and CCR5 Tg mice spent more time in the target quadrant than the other three quadrants (Figure 4—figure supplement 1C), demonstrating that with extended training CCR5 Tg mice also learned the water maze task. Altogether, the results presented demonstrate a critical role for CCR5 in learning and memory.

We tested whether CCR5 overexpression changes either MAPK or CREB signaling in CCR5 Tg mice after fear conditioning. Compared to their WT controls, CCR5 Tg mice show similar phosphorylated p44/42 MAPK levels at baseline or after fear conditioning training (Figure 4—figure supplement 2A, B and C). Although CCR5 Tg mice and their WT controls have similar phosphorylated CREB levels at baseline (Figure 4—figure supplement 3A), CCR5 Tg mice show decreased phospho-CREB levels at 3 hr after fear conditioning training (Figure 4—figure supplement 3C). Because of the critical role of CREB in memory consolidation (Bourtchuladze et al., 1994; Guzowski and McGaugh, 1997), these results suggest that the memory deficits caused by CCR5 overexpression in excitatory neurons are due to deficits in memory consolidation processes mediated by CREB (Silva et al., 1998).

Ccr5+/- mice display faster experience-dependent plasticity in the barrel cortex

To test the hypothesis that CCR5 may also be a neuronal suppressor of neocortical sensory plasticity, we studied experience-dependent plasticity in the barrel cortex. Trimming all of whiskers except for D1 produces both an increase in the responses of layer 2/3 (L2/3) cells located in deprived barrel-columns to stimulation of the spared D1 whisker, and an increase in the size of the spared whisker’s representation in the barrel cortex (Fox, 1992). Experience-dependent plasticity was assayed by measuring the single unit spike responses to the spared D1 whisker of single L2/3 neurons located in the deprived barrels surrounding the D1 barrel (Figure 5A). Although 7-days of single whisker experience is insufficient to produce experience-dependent potentiation in WT barrel cortex (Glazewski and Fox, 1996), three measures indicated faster potentiation in Ccr5+/- mice. First, penetrations in barrels surrounding D1 revealed potentiated responses to D1 stimulation in Ccr5+/- but not WT mice (Figure 5A). Second, a comparison of each cell's response to the spared versus deprived principal whisker response (vibrissae dominance) showed plasticity in Ccr5+/- (Figure 5C, deprived versus undeprived t(21) = 3.222 p<0.01, Student’s t-test) but not in WT mice (Figure 5B, deprived versus undeprived, t(11) = 1.663, p>0.05). Third, a plot of D1 response versus principal whisker (PW) response showed points above the identity line (D1>PW) only for Ccr5+/- but not WT mice (Figure 5D). Comparison of the time course of vibrissae dominance also showed a significant increase in WVDI in Ccr5+/- mice (0.396 ± 0.051), but not in WT mice (0.111 ± 0.011) after 7 days deprivation [Figure 5E; Interaction: F(2,41) = 1.398, genotype, F(1,41) = 8.919, days deprived F(2,41) = 10.20, genotype and deprivation period are significant: t = 3.05, p<0.05, Bonferroni post-tests]. These results demonstrate that Ccr5+/- mice show faster plasticity in the barrel cortex.

Ccr5+/- mice display accelerated experience dependent plasticity.

(A) Recording locations plotted on a standard barrel field map. The barrel shaded dark grey indicates the principal barrel for the spared whisker. The color of each circle represents the average response to D1 whisker stimulation (spikes per 50 stimulations) for cells in L2/3. Deprived Ccr5+/- mice showed greater proportion of penetrations responding strongly to D1 stimulation (WT: control vs deprived, p>0.99;Ccr5+/-: control vs deprived, p=0.0019, binomial test). (B) Vibrissae dominance histograms. Vibrissae dominance is calculated as D1/(PW + D1) and sorted into 10 bins (see Materials and methods). In WT mice, there is very little shift in the dominance histogram after 7 days of deprivation (n = 14). (C) The vibrissae dominance histogram shows a substantial shift right toward D1 dominance in the D1-spared Ccr5+/- mice (blue) compared with undeprived Ccr5+/- mice (red) (n = 24; p<0.01, Student’s t-test). (D) The value of the response to D1 stimulation is plotted against the same L2/3 cell’s response to principal whisker (PW) stimulation for mice subject to 7 days deprivation. A large number of Ccr5+/- (but not WT) cells lie above the unity line. (E) The average weighted vibrissae dominance index (WVDI) is plotted against deprivation period for WT and Ccr5+/- mice. Naïve WT and Ccr5+/- mice do not exhibit differences in their vibrissae dominance, however after 7 days deprivation there is an increase in WVDI in Ccr5+/- mice but not in WT mice (7-day WT vs Ccr5+/- mice: p=0.0030, ANOVA, Bonferroni post-tests). Error bars indicate SEM.


Ccr5+/- mice display greater probability and magnitude of LTP in barrel cortical neurons

To investigate whether Ccr5+/- mice also show enhanced synaptic plasticity in the barrel cortex, a spike-timing dependent protocol was used to induce low levels of LTP in L2/3 cells of WT mice. Whole cell recordings were performed in L2/3 and field stimulation was applied to L4 in the same cortical column (Figure 6A), and LTP was induced using a 5 ms pre-post interval as described previously (Kaneko et al., 2010). In WT mice, L2/3 cells showed significant LTP in just 20% of cases while in Ccr5+/- and Ccr5-/- mice the same protocol produced LTP in 70% of cases (Figure 6B, χ2 = 15.63, p<0.001, χ-squared test). On average, the WT mice did not show LTP, while the Ccr5+/- and Ccr5-/- mice showed 188.1 ± 1.45% and 164.5 ± 22.5% potentiation, respectively (Figure 6C).

Ccr5 knockout mice exhibit a higher probability of LTP than WT Mice.

(A) Schematic of LTP in vitro recordings. Whole-cell patch clamp recordings were made from pyramidal cells in L2/3 of the barrel cortex. A stimulating electrode was placed in the center of the barrel immediately below the recording site and the columnar projection from L4 to L2/3 was stimulated. (B) When LTP was induced with a spike-timing dependent protocol with a low probability of potentiation in WT mice, Ccr5+/- and Ccr5-/- mice showed a higher incidence of LTP (70% LTP in Ccr5+/- and Ccr5-/- mice vs 20% in WT, p<0.001, χ-squared test). (C) Mean amplitude of LTP. Failures and successes are averaged together to give an overall average of all recordings. Ccr5+/- and Ccr5-/- cells had larger LTP than WT cells which on average did not potentiate (n = 10 per group).


Ccr5+/- mice display lower release probability, and smaller and less frequent mEPSPs in barrel cortical neurons

Previous studies with HRasG12V mice suggest that an increase in ocular dominance plasticity, as well as in learning and memory, is accompanied by a lower synaptic release probability in the cortex (Kaneko et al., 2010; Kushner et al., 2005). Therefore, we investigated the release probability in the barrel cortex of WT, Ccr5+/- and Ccr5-/- mice, by measuring the attenuation rate of NMDA receptor mediated evoked EPSPs (Figure 7A) in the presence of the activity-dependent NMDA receptor antagonist MK-801 (Hessler et al., 1993). The release probability was significantly lower in Ccr5+/- and Ccr5-/- mice (Figure 7B, p<0.01, Kruskal-Wallis test). Consistent with this finding, mEPSPs (Figure 7C) in L2/3 cells of Ccr5+/- mice were smaller (Figure 7D, D(52) = 0.6154 p<0.001, K-S test) and occurred at a lower frequency compared to WT mice (Figure 7E, D(21) = 0.9524 p<0.001, K-S test). Both effects could create greater ‘headroom’ for LTP and experience-dependent potentiation in Ccr5 knockout mice.

Ccr5 knockout mice exhibit lower release probability, and smaller, less frequent mEPSPs than WT mice.

(A) Cells from Ccr5+/-and Ccr5-/- mice exhibited lower release probability than cells from WT mice. Traces represent normalized amplitude of NMDA-receptor mediated evoked EPSPs in the presence of the use-dependent antagonist MK-801. A faster decrease in the peak EPSP amplitude is indicative of a higher release probability. (B) Single exponential curves were fitted for the data presented in panel A, and Ccr5+/- and Ccr5-/- mice demonstrated lower Pr than WT mice (n = 10 per group; p<0.01, Kruskal-Wallis test). (C) Example miniature EPSPs recordings from WT and Ccr5+/- mice. (D) Cells from Ccr5+/- mice displayed smaller mEPSPs than WT (WT n = 10, Ccr5+/- n = 10; p<0.001, K-S test). (E) Cells from Ccr5+/- mice displayed less frequent mEPSPs than WT and therefore greater inter-event intervals (WT n = 10, Ccr5+/- n = 10;p<0.001, K-S test).


Viral knockdown of Ccr5 expression in adult barrel cortex results in enhanced experience dependent plasticity

To check whether the Ccr5+/- plasticity phenotype in the barrel cortex was dependent on a developmental effect, we also injected shRNA-CCR5 or shRNA-Cont AAV into the barrel cortex of adult C57BL/6N mice. Immuno-histochemistry confirmed that the virus exclusively infected neurons (Figure 8A and Figure 8—figure supplement 1, 35% infection rate and 100% co-localization of NeuN and GFP). Only shRNA-CCR5 mice, but not shRNA-Cont mice, exhibited a shifted vibrissae dominance histogram after 7 days of single whisker experience (Figure 8B, t(10) = 6.485 p<0.001, Student’s t-test). Knockdown of Ccr5 in the adult barrel cortex resulted in an experience-dependent plasticity phenotype that closely mirrored that of the Ccr5+/- mice (Figure 8C, Ccr5+/- mice t(20) = 2.939 p<0.01, Student’s t-test; viral knockdown: t(10) = 6.485 p<0.001, Student’s t-test), demonstrating that CCR5 is a suppressor of neocortical plasticity acting directly on neurons in the adult brain.

Figure 8 with 1 supplement see all
Viral knockdown of Ccr5 in barrel cortex enhances experience-dependent plasticity.

(A) Specificity and spread of viral infection. Interleaved slices processed for cytochrome oxidase (CytOx) confirmed viral location (GFP) over the recorded area of the barrel cortex. Arrows show lesions marking recording penetrations. Confocal images of the neuronal marker (NeuN) and viral expression (GFP) suggest that the shRNA is expressed exclusively in neurons. Scale bar = 20 µm. (B) Vibrissae dominance histogram after 7 days D1-spared single-whisker experience. Compared to control group, knockdown of Ccr5 leads to a shifted histogram (shRNA-cont n = 6; shRNA-CCR5 n = 6; p<0.001, Student’s t-test). (C) Weighted VDI values comparing Ccr5+/- mice with viral knockdowns. Viral knockdown has a similar effect to that of constitutive mutants after 7 days deprivation. Error bars indicate SEM.


Ccr5 knockout prevents V3 peptide-induced signaling, plasticity and memory deficits

Our molecular, electrophysiological, sensory plasticity and behavioral results demonstrate that CCR5 is a suppressor for plasticity and learning and memory. Therefore, it is possible that acute activation of CCR5 by HIV coat proteins could contribute to deficits in neuroplasticity and thereby learning and memory. To explore this hypothesis, we tested whether the HIV gp120 V3 loop peptide results in plasticity and learning deficits, and whether CCR5 is responsible for these deficits. The HIV gp120 V3 loop peptide contains the gp120 domain that binds to and activates CCR5 (Cormier and Dragic, 2002; Galanakis et al., 2009; Morikis et al., 2007; Sirois et al., 2005). Immunoprecipitation with anti-HA-agarose, to co-precipitate V3-HA peptide and CCR5 in mouse hippocampal lysates, demonstrated that V3 peptide binds to mouse hippocampal CCR5 (Figure 10—figure supplement 1).

To examine the effects of V3 peptide on neuroplasticity and the possible role of CCR5 in this, we repeated the cortical LTP study shown in Figure 6 after pre-incubation for one hour with either 200 pM V3 peptide fragment or saline (control). In cells from WT mice, V3 treatment had a strong effect on the magnitude and probability of LTP (Figure 9A,B), completely abolishing any instance of LTP and producing an average depression of 27.8% (t(120) = 26.6, p<0.001, Student’s t-test). Cells from Ccr5+/- mice still displayed a similar proportion of LTP (75% V3-treated vs 62.5% control, Figure 9D) but showed significantly lower potentiation than in control conditions (127% V3 vs 208% control, Figure 9C, t(120) = 42.2, p<0.001, Student’s t-test). In contrast, cells from mice lacking CCR5 (Ccr5-/- mice) were not affected by V3 treatment at all, with higher probability of LTP (86% V3 vs 66% control, Figure 9F) and a similar magnitude of potentiation (186% V3 vs 182% control, Figure 9E). Similar effects of V3 treatment on plasticity were observed in hippocampal slices from WT mice and Ccr5 knockout mice. Analyses of hippocampal slices, that had been pre-incubated 1 hr with 200 pM V3 peptide, revealed Schaffer collateral fEPSPs LTP deficits between 50 and 60 min post-TBS (theta burst stimulation) in WT (Figure 9G, t(14) = 2.53, p<0.05, Student’s t-test), but not from Ccr5+/- (Figure 9H, t(13) = 1.74, p=0.105, Student’s t-test) and Ccr5-/- mice (Figure 9I, t(12) = 0.994, p=0.340, Student’s t-test). These results demonstrate that V3 peptide causes LTP deficits both in barrel cortex and hippocampus.

Ccr5 knockout prevents gp120 V3 peptide induced long-term potentiation deficits both in hippocampus and in barrel cortex.

(A) Whole-cell patch clamp recordings were made from pyramidal cells in L2/3 of the barrel cortex of WT mice. When LTP was induced with a spike-timing dependent protocol, in control conditions the trace showed no significant potentiation, while V3 peptide treatment caused significant depression (n = 8 for both Control and V3; ***p<0.001, Student’s t-test). (B) WT control cells showed equal proportions of LTP, LTD and no change; In contrast, 7 out of 8 V3-treated cells showed LTD. (C) Cells from Ccr5+/- mice showed strong LTP under control conditions, while V3-treated cells show significantly reduced LTP (n = 8 for both Control and V3; ***p<0.001, Student’s t-test). (D) Although LTP magnitude was reduced in V3-treated cells, the proportion of cells undergoing potentiation in slices from Ccr5+/- mice was similar to control. (E, F) Both control cells and V3-treated cells from Ccr5-/- mice showed strong potentiation, with no significant difference in amplitude and in the probability of LTP (Control n = 6, V3 n = 7; p=0.25). (G) Hippocampal CA1 fEPSPs were recorded in hippocampal slices before (baseline) and after 5 TBS (theta bursts stimulation). V3 peptide resulted in LTP deficits in the fEPSP measured during the last 10 min of recordings in hippocampal slices from WT mice (n = 8 for both Control and V3; *p<0.05, Student’s t-test). (H, I) V3 peptide treatment had no significant effect on Ccr5+/- (control n = 8, V3 n = 7; p=0.105, Student’s t-test) and Ccr5-/- mice (control n = 7, V3 n = 7, p=0.340, Student’s t-test). Error bars indicate SEM.


To examine the effect of V3 peptide on learning and memory, mice received a single hippocampal V3 peptide infusion (concentration 2 μg/μl, 1 μl peptide to each hemisphere with the infusion speed of 0.1 μl/min) either 30 min before or immediately after contextual fear conditioning (Figure 10A). When injected 30 min before fear conditioning, V3 peptide caused contextual memory deficits in C57BL/6N mice (Figure 10B, t(10) = 4.04, p<0.01, Student’s t-test). In contrast, V3 peptide infusions following training did not affect contextual fear memory (Figure 10C, t(18) = 0.92, p=0.37, Student’s t-test), indicating that the V3 peptide must be present during training to disrupt learning and memory.

Figure 10 with 1 supplement see all
Both Ccr5 knockout and knockdown protect against gp120 V3 peptide induced memory deficits.

(A) Schematic of V3 peptide infusion and fear conditioning for the experiments shown in B and C. (B) 30 min after V3 peptide infusion into hippocampus, C57BL/6N mice were trained with fear conditioning. V3 peptide caused contextual memory deficits (Cont n = 6, V3 n = 6; **p<0.01, Student’s t-test). (C) When V3 peptide was infused into hippocampus immediately after fear conditioning training, no difference was observed between the control group and the V3 peptide group (Cont n = 10, V3 n = 10). (D) Schematic for experiments shown in E and F. (E) 30 min after V3 peptide infusion into hippocampus, mice were trained with fear conditioning. V3 peptide caused contextual memory deficits in WT mice, but Ccr5 knockout protected against V3-induced memory deficits (WT/Cont n = 10, WT/V3 peptide n = 11, Ccr5+/-/Cont n = 8, Ccr5+/-/V3 peptide n = 11, Ccr5-/-/Cont n = 8, Ccr5-/-/V3 peptide n = 8; *p<0.05, **p<0.01, ***p<0.001, Two-way ANOVA). (F) V3 peptide caused contextual fear conditioning memory deficits in mice injected with shRNA-Cont AAV, but hippocampal Ccr5 knockdown protected against V3-induced memory deficits (shRNA-Cont/Cont n = 10, shRNA-Cont/V3 n = 9, shRNA-CCR5/Cont n = 10, shRNA-CCR5/V3 n = 9; *p<0.05, **p<0.01, Two-way ANOVA). Error bars indicate SEM.


When V3 peptide was infused into the hippocampus of WT, Ccr5+/- or Ccr5-/- mice 30 min before training (Figure 10D), the V3-induced memory deficit was prevented by the Ccr5+/- or Ccr5-/- mutation [Figure 10E; Two-way ANOVA, overall (genotype × treatment) interaction: F(2,50) = 1.0; Main effect of treatment: F(1,50) = 11.10, Post hoc linear contrast: WT/Cont versus WT/V3, t(50) = 3.25 p<0.01, Bonferroni post-tests]. To examine whether decreasing Ccr5 expression specifically in hippocampus is sufficient to block V3-induced memory deficit, shRNA-Cont or shRNA-CCR5 AAV was injected to the hippocampus, and two weeks later, V3 peptide was infused into the hippocampus, and mice were trained 30 min after V3 peptide infusion. Similar to the effects in WT mice, V3 peptide caused memory deficits in shRNA-Cont mice. Importantly, these deficits were prevented by hippocampal Ccr5 knockdown [Figure 10F; Two-way ANOVA, overall (shRNA virus × treatment) interaction: F(1,34) = 0.61; Main effect of treatment: F(1,34) = 7.19; Post hoc linear contrast: shRNA-Cont/Cont versus shRNA-Cont/V3, t(34) = 2.45 p<0.05; shRNA-Cont/Cont versus shRNA-CCR5/Cont, t(34) = 2.55 p<0.05; shRNA-Cont/V3 versus shRNA-CCR5/V3, t(34) = 3.50 p<0.01, Bonferroni post-tests], demonstrating that CCR5 is an in vivo target for the V3 peptide-dependent memory deficits.

Since our results indicate that CCR5 regulates MAPK/CREB signaling, we next determined whether an acute injection of the V3 peptide into the dorsal hippocampal CA1 area results in deficits in MAPK or CREB activation after learning (Figure 11A). P44/42 pMAPK and pCREB levels in the dorsal hippocampal CA1 subregion (Lein et al., 2004) were measured 1 hr or 3 hr after learning, respectively. Compared to controls, V3 peptide resulted in a significant decrease in pMAPK (Figure 11B, t(11) = 2.71 p<0.05, Student’s t-test), but had no effect on pCREB (Figure 11C). A similar decrease in pMAPK was observed when the V3 peptide was infused into the hippocampus of mice injected with shRNA-Cont AAV. Importantly, this decrease in pMAPK activation after learning was ameliorated by hippocampal Ccr5 knockdown [Figure 11D; Two-way ANOVA, overall (shRNA virus × treatment) interaction: F(1,28) = 0.35; Main effect of treatment: F(1,28) = 11.8, Post hoc linear contrast: shRNA-Cont/Cont versus shRNA-Cont/V3, t(28) = 2.85 p<0.05; shRNA-Cont/V3 versus shRNA-CCR5/V3, t(28) = 2.48 p<0.05, Bonferroni post-tests]. Interestingly, unlike the Ccr5+/- mice, that showed enhanced pMAPK activation after learning (Figure 2B), compared to shRNA-Cont mice, mice injected with shRNA-CCR5 AAV did not show enhanced pMAPK, probably because in these mice Ccr5 was knocked down in only the subset of hippocampal neurons transfected by the AAV virus. Altogether, these results indicate that decreasing CCR5 protects against the acute deficits caused by V3 peptide on hippocampal MAPK signaling, synaptic plasticity, and learning and memory, a result consistent with the idea that CCR5 activation contributes to the cognitive deficits triggered by HIV proteins.

Ccr5 knockdown ameliorates hippocampal p44/42 MAPK signaling deficits caused by V3 peptide treatment.

(A) The dorsal hippocampal CA1 subregion was extracted 1 hr after training. V3 peptide reduced p44/42 pMAPK levels at 1 hr after fear conditioning (Cont n = 6, V3 n = 7; *p<0.05, Student’s t-test). (B) V3 peptide had no effect on pCREB when dorsal hippocampal CA1 subregion was extracted 3 hr after fear conditioning (Cont n = 5, V3 n = 6). (C) V3 peptide reduced p44/42 pMAPK in the dorsal CA1 of mice injected with shRNA-Cont virus at 1 hr after fear conditioning, but Ccr5 knockdown ameliorated the decrease in p44/42 pMAPK levels observed after learning (n = 8 for each group; *p<0.05, Two-way ANOVA). Error bars indicate SEM.



CCR5 is a chemokine receptor that plays an important role in inflammatory responses. A learning and memory reverse genetic screen showed that the Ccr5 knockout results in enhanced learning and memory for contextual fear conditioning. This phenotype was confirmed in other learning and memory tasks including the water maze and social recognition. Importantly, the Ccr5 knockout did not affect a number of behaviors that could have confounded the learning and memory findings, including anxiety, activity, social interaction, cued conditioning, and shock reactivity. This enhancement in learning and memory is consistent with increases in plasticity at the systems and cellular levels. In the barrel cortex, Ccr5 knockout results in dramatically accelerated experience-dependent plasticity: Ccr5+/- mice showed robust experience-dependent sensory plasticity at a time point (7-days after whisker removal) when WT mice show no evidence of plasticity. Importantly, temporally and spatially restricted knockdown of Ccr5, specifically in adult hippocampus or barrel cortex, also resulted in enhancements in learning and memory as well as experience-dependent plasticity, demonstrating that these effects are not due to changes during development.

MAPK and CREB have been implicated in learning and memory (Bourtchuladze et al., 1994; Roth and Sweatt, 2008). Our results indicate that the Ccr5 knockout did not alter MAPK or CREB signaling under baseline conditions. However, Ccr5 knockout resulted in an increase in MAPK and CREB signaling levels at 1- and 3 hr after training, respectively. Enhanced MAPK or CREB signaling have been associated with enhancements in learning and memory. For example, HRasG12V mice have enhanced MAPK levels following training, and show increases in LTP and sensory plasticity, as well as enhancements in learning and memory tested in a number of tasks (Kaneko et al., 2010; Kushner et al., 2005); Similarly, enhanced CREB signaling is also associated with memory enhancements in multiple tasks and model systems (Czajkowski et al., 2014; Kathirvelu and Colombo, 2013; Zhou et al., 2009) and in barrel cortex plasticity (Barth et al., 2000; Glazewski et al., 1999). Altogether, these results indicate that increases in MAPK and CREB signaling are integral to the learning and memory enhancements in the Ccr5 knockout mice.

Ccr5 knockout mice show enhanced long-term synaptic plasticity changes both in hippocampus and barrel cortex. For example, our spike pairing protocol in the cortex induced LTP 20% of the time in WT mice and 70% of the time in the Ccr5 knockout mice. Our neocortical studies also showed that similar to HRasG12V mice (Kaneko et al., 2010; Kushner et al., 2005), Ccr5+/- mice also have lower release probability and lower mini-amplitudes. The initial conditions present at the synapses of Ccr5+/- mice thereby create the headroom for greater pre- and post-synaptic potentiation at the synapse, both of which are important components of plasticity (Dachtler et al., 2011; Hardingham and Fox, 2006). Together with the increased responsiveness of the MAPK/CREB signaling pathway, the naive state of the synapse under CCR5 hypo-function creates a potent mix for increased synaptic potentiation.

In agreement with the enhanced learning and memory with manipulations that decrease CCR5, transgenic mice that overexpress CCR5 in excitatory neurons show learning and memory deficits, demonstrating that CCR5 acts as a suppressor for plasticity and memory. Although a previous study (Lee et al., 2009) reported learning and memory deficits in aged CCR5 mutants, this study used aged mice (12–18 month old) and the control mice with a different genetic background. Our CCR5 transgenic results suggested that CCR5 activation by viral proteins, and subsequent plasticity and memory suppression, may contribute to HIV associated impairments in cognition.

A recent study reported that transgenic mice overexpressing an HIV viral protein (gp120) showed neuronal degeneration and subsequent behavioral deficits that could be ameliorated by a Ccr5 mutation (Maung et al., 2014). Similarly, multiple doses of gp120 in rats also resulted in physiological and cognitive deficits (Tang et al., 2009). Interestingly, our study shows that acute treatment (one injection 30 min before training) of HIV gp120 V3 loop peptide, which is known to bind and activate CCR5 in the brain (Chan et al., 1999; Shah et al., 2006; Sirois et al., 2005), was sufficient to induce deficits in a key cellular mechanism for learning and memory (LTP) and also in hippocampus-dependent learning and memory in WT mice. Remarkably, these deficits were prevented by either a viral-mediated Ccr5-knockdown or by a Ccr5 knockout mutation. The V3 loop is important for HIV binding to CCR5 or CXCR4, and LTP deficits caused by the V3 loop peptide had been reported to be blocked by a CXCR4 antagonist (Dong and Xiong, 2006). Nevertheless, our results show that both in the barrel cortex and in hippocampus, the LTP deficits caused by the V3 peptide are prevented by the homozygous Ccr5 mutation, demonstrating that CCR5 plays a critical role in the V3-induced deficits in neuroplasticity. CCR5 antagonists and inhibitors have shown efficacy in reduction of viral load in clinical studies (Fätkenheuer et al., 2005; Gulick et al., 2008). Our findings support the application of brain permeable CCR5 antagonists, not only as a combination drug in antiretroviral (ARV) therapy, but also as a treatment for cognitive deficits caused by HIV coat proteins.

Previous studies showed that the establishment of long-lasting synaptic changes and long-term memory requires the removal of inhibitory constraints on MAPK/CREB signaling (Abel et al., 1998). Our findings with Ccr5 knockout, region-specific viral knockdown, and neuronal CCR5 over-expression demonstrate that CCR5 functions as a plasticity and memory suppressor by acting on the MAPK/CREB signaling pathway. Our results also suggest that the inappropriate activation of this suppressor by HIV coat proteins contributes to cognitive deficits. Since decreasing CCR5 function leads to robust increases in plasticity and memory, CCR5 provides a novel target for cognitive enhancement, and for the development of treatments for cognitive deficits.

Materials and methods


3-month old C57BL/6N and Ccr5 knockout (Ccr5-/-) mice were purchased from Taconic Farms (Germantown, NY) and tested in a reverse genetic screen (Figure 1—figure supplement 1). Ccr5-/- mice were then bred with C57BL/6N mice to generate Ccr5+/-. Experimental WT, Ccr5+/-, and Ccr5-/- mice (3 to 5 months old) were generated by intercrossing Ccr5+/- mice. Littermates were used for all experiments (except the initial reverse genetic screen). Experimental Ccr5-overexpressing transgenic mice were generated and maintained in the C57BL/6N background. Yfp+/Ccr5+/- mice were generated by breeding male Thy1-YFP mice with female Ccr5+/- mice, and 3 to 6 months old Yfp+/Ccr5+/- mice and their littermates Yfp+/Ccr5+/+ (Yfp+/WT) mice were used for the spine density experiment. 10-week-old male C57BL/6N mice were purchased from Taconic Farms (Germantown, NY) for shRNA-cont or shRNA-CCR5 AAV injections and for the V3 loop peptide experiments. Mice were group housed with free access to food and water, and maintained on a 12:12 hr light:dark cycle. All experiments were performed during the light phase of the cycle. All studies were approved by the Animal Research Committee at UCLA and University of Cardiff and carried out in compliance with the United Kingdom’s Animals (Scientific Procedures) Act 1986 where applicable.

Fear conditioning

For the reverse genetic screen for remote memory phenotypes, mice were subjected to a training session with a total time of 8 min. The mice were allowed to explore the training chamber for 2 min, and then 3 tone-shock pairs (2 s 0.75 mA shock co-terminated with 30 s tone) were delivered and the 3 tones started at 2, 3 and 4 min. Two weeks after training, the mice were first returned to chambers (context B) which were different from the training chambers (context A) for the cued memory test (tone test), and 90 min later mice were returned to the training chamber for a 5 min test to assess contextual memory. Standard Z scores were used to present the results of the memory screen, which combine both freezing and suppression of activity ratios (SR) scores from the same mice. Suppression of activity ratios (SR) were calculated as SR=(test activity)/(test activity + baseline activity). Z scores for the entire wild type population were calculated as Z score=(individual-population mean)/standard deviation, and the expected value is a mean of 0 and a standard deviation of 1. Z scores for each mutant were calculated as: Z score= average[(%Freezing individual–%Freezing population mean)/(standard deviation of population), (−1)*(SR individual–SR population mean)/(standard deviation of the population)]. So Z scores reflect alterations in both freezing and activity suppression caused by different genetic mutations, with simplified comparisons and improved reliability (Matynia et al., 2008).

To test contextual memory for Ccr5 knockout or knockdown mice, the mice were subjected to a training session with a total time of 5 min. Mice were allowed to explore the training chamber for 2 min, and then 3 shocks (2 s, 0.75 mA) were delivered at 2, 3 and 4 min. To test contextual memory for CCR5 transgenic mice, the mice were either subjected to a daily weak training for 5 days, or to a context pre-exposure fear-conditioning paradigm. During the daily weak conditioning, the mice were allowed to explore the training chamber for 25 s, and then a 1 s, 0.4 mA shock were delivered and mice were removed for the training box 5 s after the shock. The freezing levels during the 25 s period before the shock were used to measure contextual memory. For the context pre-exposure fear conditioning, the mice were pre-exposed to the training context for 7 min on day 1. The mice were brought back to the same context on day 2, and 10 s later received 3 shocks (0.75 mA) with 5 s interval between the 3 shocks. The mice were removed from the training boxes 40 s after the last shock. On day 3, the mice were tested for 5 min in the same training context.

Morris water maze

In the hidden version of the Morris water maze, mice were trained with two blocks per day for 5 days and each block consisted of two trials with 30 s interval between the trials. In each trial, mice were given 60 s to find the platform. If mice found the platform earlier than 60 s, the trial ended then. If mice failed to find the platform, the trial terminated at 60 s. After each trial, mice were put on the platform for 15 s (Ccr5+/- and shRNA-CCR5 mice) or 20 s (CCR5 transgenic mice). Probe tests with a time of 60 s were administered after two days of training (Ccr5+/- and shRNA-CCR5 mice and their controls) or after three days of training (CCR5 transgenic mice and their controls). Testing at day 2 maximized our ability to see enhancements, while testing at day 3 maximized our ability to see deficits. To examine whether mice from different groups were able to learn the Morris water maze task with extended training, a second probe test was performed after five days of training. Mice showing floating behavior during training or probe test were excluded from further training or from data analysis. Floating behavior was judged by mouse swimming speed, and mice with a swimming speed lower than (average speed – 2 × SD (standard deviation)) were excluded.

Social recognition

Mice were handled for 3 days (2 min handling each day) before social recognition task. During the 3- day social recognition task, mice were first habituated to the testing chamber for 10 min on day 1. On day 2, mice were placed back into the same chamber and habituated for 5 min, and then were allowed to interact for 7 min with an ovariectomized (OVX) female mouse placed under a wired cylinder (training session). On day 3, mice were placed back into the same chamber and habituated for 5 min, and then were allowed to interact with two OVX females (one familiar and one novel) for 5 min (test session). The time mice spent on exploring (sniffing) the OVX mice were hand scored by experimenters blinded of mouse genotypes and of familiar or novel OVX mice.

Open field

Mice were placed in a novel open field (28 cm × 28 cm × 25 cm), and were allowed to explore it for a period of 20 min. The total distance mice traveled, and percentage time mice spent in the peri- or center region of the open field were analyzed.

Elevated plus maze

Mice were placed on an elevated plus maze and were allowed to explore it for 5 min. The elevated plus maze has two open arms and two close arms (with walls of 16.5 cm height), and each arm is 29 cm long and 8 cm wide. The percentage of time mice spent in the open arms, and open arm entry times were analyzed.

Ccr5 knockdown efficiency measurement

To measure Ccr5 knockdown efficiency, HEK 293 cells were co-transfected with CCR5-tdTomato plus either shRNA-CCR5 or shRNA-Cont (dsRed) plasmids. HEK293 cells were ordered from ATCC (CRL-1573) and were tested with Mycoplasma Detection Kit (R&D Systems, CUL001B) to make sure there was no contamination. One day after plasmid transfection, cells were imaged to examine the effect of shRNA-CCR5 on CCR5-tdTomato expression. Ccr5 knockdown efficiency was also tested by measuring Ccr5 mRNA expression in the hippocampus one month after the injection of AAV containing shRNA-cont or shRNA-CCR5. To measure Ccr5 mRNA expression, tissue samples were collected from the dorsal hippocampus and total RNA was extracted by RNeasy Mini Kit (Qiagen, Valencia, CA, USA) and treated with DNase (Qiagen). Total RNA was first reverse-transcribed into cDNA using oligo (dT) primers and Superscipt III First-Strand Synthesis System (Invitrogen, Carlsbad, CA, USA), and was then quantified by qPCR. The following primer sequences were used for the Ccr5 qPCR: 5’GCTGCCTAAACCCTGTCATC 3’(forward) and 5’GTTCTCCTGTGGATCG GGTA3’ (reverse). The ribosome protein RPL13A was used as a housekeeping control.

Immunoblotting for hippocampal samples

Dorsal hippocampus was homogenized with RIPA buffer (Sigma, St. Louis, MO, R0278) supplemented with protease inhibitor cocktail (Sigma, P8340), phosphatase inhibitor cocktail 2 (Sigma, P5726), phosphatase inhibitor cocktail 3 (Sigma, P0044), and 0.5% SDS. After measuring protein concentration with the BCA protein assay kit (Pierce, Rockford, IL, 23225), protein samples were loaded to NuPAGE Novex 4–12% Bis-Tris protein gel (ThermoFisher Scientific, Carlsbad, CA, NP0336BOX), and after separation, proteins were transferred onto polyvinylidene difluoride (PVDF) membranes. The PVDF membranes were blocked with 5% nonfat milk at room temperature for 1 hr and then probed with primary antibodies (phospho-CREB, Cell Signaling 9198, 1:4000 dilution; phospho-p44/42 MAPK, Cell Signaling 9101, 1:10,000 dilution) at 4°C overnight. Membranes were then incubated with secondary antibodies for 1 hr and developed with ECL solutions. The phospho-CREB or phospho- p44/42 MAPK primary antibodies was stripped with Restore western blot stripping buffer (ThermoFisher Scientific, 21059). After stripping, the PVDF membranes were blocked with 5% nonfat milk at room temperature for 1 hr and then probed with primary antibodies (CREB, Cell Signaling 9197, 1:1000 dilution; p44/42 MAPK, Cell Signaling 9102, 1:4000 dilution) at 4°C overnight. Membranes were then incubated with secondary antibodies for 1 hr and developed with ECL plus solutions and scanned with Typhoon 9410 imager and quantified with imageJ.

Immunostaining for hippocampal samples

Mice were transcardially perfused with 4% PFA (4% paraformaldehyte in 0.1 M phosphate buffer) and after perfusion brains were extracted and incubated with 4% PFA overnight at 4°C. Coronal sections were cut at 50 µm on a microtome and transferred to PBS, then blocked in 5% Normal Goat Serum in 0.1 M PBS and 0.1% TritonX-100 for 1 hr. After blocking sections were incubated in a primary antibody mix (in 0.1 M PBS, 0.2% TritonX-100 and 5% Normal Goat Serum) of rabbit anti-GFP (Abcam AB6556, 1:500 dilution), mouse anti-Neun (Chemokon, MAB377, 1:1000), and rabbit anti-GFAP (Dako Z0334, 1:500) or rabbit anti-Iba1 (Wako 019–19741, 1:500) for two days at 4°C. After 3 × 15 min washes in 0.1 M PBS and 0.1% TritonX-100 the secondary antibodies were applied (in 0.1 M PBS, 0.2% TritonX-100 and 3% Normal Goat Serum): Alexa488 goat anti-rabbit (Invitrogen A-11034, 1:500 dilution), Alexa568 goat anti-rabbit (Invitrogen A-11011, 1:500 dilution), and Alexa647 goat anti-mouse (Invitrogen A-21235, 1:500 dilution). Slices were incubated in the secondary mix for 2 hr at room temperature. After 2 × 15 min washes in 0.1 M PBS and 0.1% TritonX-100, slices were incubated with 4’,6-diaminodino-2-phenylindole (DAPI, Life Technologies D-21490, 1:2000) for 15 min, and then were further washed with 0.1 M PBS and 0.1% TritonX-100 for 15 min before mounted onto slides with ProLong Gold antifade mounting media (Life Technologies, P36934). All immunostaining images were acquired with a Nikon A1 Laser Scanning Confocal Microscope (LSCM).

Immunostaining for cortical samples

Candidate mice were transcardially perfused, as described in the in vivo electrophysiology section, three weeks after injection of AAV. Fixed brains were removed and stored whole in 20% sucrose PBS after 24 hr postfix in 4% formaldehyde/20% sucrose PBS. Coronal sections were cut at 40 µm on a freezing microtome and transferred to PBS, then blocked in 5% Normal Goat Serum in 0.1 M PBS and 0.1% TritonX-100 for 1 hr. After blocking sections were incubated in a primary antibody mix (in 0.1 M PBS, 0.1% TritonX-100 and 3% Normal Goat Serum) of chicken polyclonal anti-GFP (Abcam AB13970, 1:500 dilution) and mouse monoclonal anti-NeuN (Millipore MAB377, 1:100 dilution) for 2 hr at room temperature, 18 hr overnight at 4°C and a further 2 hr at room temperature. After 3 × 30 min washes in 0.1 M PBS and 0.1% TritonX-100 the secondary antibodies were applied (in 0.1 M PBS, 0.1% TritonX-100 and 3% Normal Goat Serum): Alexa488 goat anti-chicken (Life Technologies A11039, 1:200 dilution) and Alexa594 goat anti-mouse (Life Technologies A11032, 1:200 dilution). Slices were incubated in the secondary mix for 3.5 hr at room temperature, and then after a further 3 × 20 min washes in 0.1 M PBS and 0.1% TritonX-100 were mounted in Vectashield DAPI hardset (Vector H1500). The same protocol was applied to tangential slices alternating with slices stained for cytochrome oxidase to localise viral spread across barrels. Coronal sections were visualized using a Leica TCS SP2 confocal microscope and tangential sections were visualized with an Olympus BX61 microscope in both epifluorescent and transmissive brightfield modes. Colocalisation of staining in confocal images was automatically quantified with Imaris F1 7.7.2 (Bitplane, Zurich, Switzerland).

Hippocampal viral injection surgery

To knockdown Ccr5 in pyramidal fields of the hippocampus, high titers of Adeno-associated virus (AAV) engineered to knock-down Ccr5 with an shRNA approach (shRNA-Cont or shRNA-CCR5 viruses, 0.7 μl, 1 × 1013 unit/ml) were stereotaxically injected into the hippocampal CA1 sub region of 3 months old C57Bl/6Tac mice through a 30-gauge Hamilton microsyringe at four sites at the following coordinates relative to bregma (mm): AP: −1.8, ML: ±0.8, DV: −1.6; or AP: −2.5, ML: ±2, DV: −1.6). After infusion, the microsyringe was left in place for an additional 5 min to ensure full virus diffusion. After surgery, mice were treated with antibiotics and their health was monitored every day for two weeks.

Hippocampal V3 peptide infusion

To infuse V3 loop peptide (CTRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC, Disulfide Bridge: 1–35) into hippocampus, two cannula were implanted at the following coordinates relative to bregma (mm): AP: −2.1, ML: ±1.7, DV: −1.6. Two weeks after cannulation, either at 30 min before fear conditioning training or immediately after training, mice were anesthetized and saline (control) or V3 peptide (concentration 2 μg/μl) was infused into hippocampus with the infusion speed 0.1 μl/min and 1 μl solution to each hemisphere. After infusion, the injector was left in place for an additional 5 min to ensure full diffusion.

V3-HA peptide immunoprecipitation

V3-HA peptide (CTRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHCGYPYDVPDYA, Disulfide Bridge: 1–35, from GenScript) and hippocampal CCR5 binding was detected with Pierce co-Immunoprecipitation (Co-IP) kit. Mouse hippocampal tissue was prepared with IP Lysis/Wash Buffer, and was mixed with anti-HA-agarose (Sigma) and incubated overnight at 4°C with or without V3-HA peptide. After elution, the samples were detected with CCR5 antibody (Santa Cruz Biotechnology) with western blot.

Cortical viral injection surgery

To knockdown Ccr5 in the barrel cortex, subjects (C57Bl/6N mice; Taconic Farms, Ry, Denmark) aged 2–3 months at time of surgery were anaesthetized with ketamine/xylazine (80/6 mg/kg) and immobilized in a stereotaxic frame (David Kopf Instruments, Tujunga, CA) with a thermostatically controlled heating blanket (Harvard Instruments). The left parietal cranium was exposed and kept moist with sterile cortex buffer. A dental drill was used to make a small craniotomy over the likely location of the D1/D2 barrel (from bregma: AP: −1.5, ML: ±3), the dura resected with a 30 G hypodermic needle and a pulled sharp bevelled glass pipette attached to a Hamilton syringe (Esslab, Essex, UK) was carefully inserted to a depth of 300 µm (DV: −0.3). After 2–3 min 100 nl of high-titre (1 × 1013 unit/ml) AAV was injected over a 5 min period. Fast green was added to the virus to allow visual confirmation of the injection. The incision was closed with sutures and mice were allowed to recover for three weeks before starting the deprivation protocol.

In vivo electrophysiology


Mice aged between P50 and P90 were anesthetized with isoflurane and maintained by urethane (1.5 g/kg body weight i/p) plus a trace amount of acepromazine. Supplemental doses of urethane (10% of the initial dose) were administered as required to maintain anaesthesia depth. Analgesic (lidocaine) was applied to the ears and scalp. Deprived vibrissae were replaced by attaching the corresponding contralateral whisker to the trimmed stub with cyanoacrylate adhesive. Naïve mice had their whiskers acutely cut and re-attached to minimize mechanical differences between cohorts.


Mice were immobilized in a stereotaxic frame (Narashige, Japan) and body temperature maintained at 37°C with a thermostatically controlled heating blanket (Harvard Apparatus, Kent, UK). A 2 × 2 mm section of the left parietal cranium was thinned with a dental drill over the barrel cortex (0–2 mm caudal from bregma and 2–4 mm lateral from midline). Before each penetration a small fleck of bone was removed from the recording site with a 30 G hypodermic needle just large enough to introduce the electrode.


Recordings were made from barrels corresponding to the spared whisker and its immediate surrounding deprived barrels using carbon fibre microelectrodes. Action potentials were isolated with a window discriminator to provide single-unit recordings, recorded with a Neurolog system (Digitimer, Welwyn Garden City, UK) and digitised with a CED 1401 and Spike2 software (CED, Cambridge, UK) running on a Windows PC.

Stimulation of whiskers was performed with a 3 × 3 matrix piezo-electric stimulator (Cardiff University Mechanical Engineering Centre) driven by a CED 3901 piezo amplifier (CED, Cambridge, UK). Stimuli were applied as a trapezoidal ramp with 10 ms rise time, 10 ms plateau and 10 ms return time, peak deflection was 300 µm (20° whisker deflection). Receptive fields were mapped using pseudorandom sequences in blocks of 10 (9 whiskers and one blank field) at 5 Hz (Jacob et al., 2010, 2012).


Recording sites were confirmed by histology. After each penetration a small lesion (1 µA DC for 10 s, tip negative) was made at 350 µm estimated depth. At the end of the experiment the mouse was deeply anaesthetized and transcardially perfused with 0.1 M phosphate-buffered saline, followed by 4% formaldehyde in PBS. The brain was carefully removed after fixation and the cortex flattened between two glass slides as previously described (Strominger and Woolsey, 1987). After 24 hr postfix in 4% formaldehyde and 20% sucrose in PBS flattened cortices were transferred to 20% sucrose in PBS until sectioning. Tangential sections (35 µm) were cut on a freezing microtome and reacted with diaminobenzidine and cytochrome C to stain for cytochrome oxidase activity (Wong-Riley, 1979). This procedure allows for clear identification of the barrels and confirmation of the recording site.

In vitro electrophysiology

Slicing procedure

Mice aged between P50 and P60 were killed by cervical dislocation, decapitated and the brain quickly removed and cooled in ice-cold dissection buffer (in mM: 108 choline-Cl, 3 KCl, 26 NaHCO3, 1.25 NaH2, PO4, 25 D-glucose, 3 Na-pyruvate, 1 CaCl2, 6 MgSO4, 285 mOsm) bubbled with 95% O2/5% CO2. Coronal slices (350 µm thick) were cut on a vibrating microtome (Microm HM650V, Thermo Fisher, Cheshire, UK) and transferred to a holding chamber containing normal artificial CSF (in mM: 119 NaCl, 3.5 KCl, 1 NaH2PO4, 10 D-glucose, 2 CaCl2, 1 MgSO4, 300 mOsm) bubbled with 95% O2/5% CO2. Slices were incubated at 32°C for 45 min after slicing, then returned to room temperature until recording.


Whole cell recordings were performed at 35–37°C. Barrels were identified in slices under bright field illumination using an Olympus BX50WI microscope. Pyramidal neurons were identified using DIC optics. Recording pipettes (4–10 MΩ) were pulled from borosilicate glass (Clark GC150-F10, Harvard Apparatus, UK) and filled with a potassium gluconate-based recording solution (in mM: 110 K-gluconate, 10 KCl, 2 MgCl2, 2 Na2ATP, 0.03 Na2GTP, 10 HEPES, pH 7.3, 270 mOsm). LII/III pyramidal cells were selected for their characteristic regular spiking behavior under depolarizing current. Recordings were aborted if Vm deviated spontaneously by more than 5 mV, or access resistance deviated by more than 20% during the recording. An Axon Multiclamp 700 B (Molecular Devices, Sunnyvale, CA) in current clamp mode was used as the patch amplifier and signals were telegraphed to and digitised by a CED 1401 with Signal software (CED, Cambridge, UK) running on a Windows PC.

LTP experiments

A tungsten monopolar stimulating electrode was placed centrally to a selected barrel in layer IV and suitable pyramidal neurons were identified in the area vertically above the stimulating electrode. Once a whole cell recording was established extracellular stimulus was applied at 0.1 Hz, consisting of a pairs of pulses at 20 Hz. The stimulus was of 0.2 ms duration and 1–35 V intensity, designed to produce a monosynaptic EPSP of 3–6 mV in the postsynaptic cell. After 10 min of baseline recording, LTP was induced by pairing a suprathreshold 2.5 ms somatic depolarizing pulse with a single presynaptic stimulus (5 ms pre-post interval). Four runs of 50 paired stimuli at 2 Hz were delivered at 0.025 Hz. After LTP induction the stimulus paradigm was switched back the same as in the baseline recording and one hour of post-paring data were acquired. EPSP amplitudes were calculated as the peak response above the preceding baseline voltage. Significant potentiation was calculated by comparing mean EPSP amplitude at 50–60 mins after LTP induction with mean baseline EPSP amplitude using Student’s t-test.

Release probability experiments

The position of the recording and stimulating electrodes were identical to those for the LTP experiments. Once the recordings were established the perfusion solution was switched to magnesium-free ACSF and an NMDA-receptor mediated response was isolated by the addition of 20 µM CNQX to the bath solution. Single extracellular stimuli were delivered at 0.1 Hz. After a stable baseline had been established, stimulation was halted and 10 µM MK-801 was washed onto the slice for 10 min. Stimulation was then resumed as before and at least 100 further stimulus trials were recorded, still in the presence of MK-801 and CNQX in Mg-free ACSF. Single and double-exponential fits of the response amplitude over time were performed with GraphPad Prism 5 and 6 (GraphPad, La Jolla, CA). The rate of decrease in the NMDAr-mediated EPSPs is directly related to the release probability of synapses in the observed pathway.

mEPSP recordings

Recordings were made in layer II/III pyramidal cells. Miniature AMPA receptor-mediated EPSPs were isolated by the bath application of 1 µM tetrodotoxin, 100 µM picrotoxin and 50 µM D-AP5. Action potential blockade was confirmed with the injection of highly-depolarizing square current pulses (0.8–1 nA, 500 ms). 100–500 events were analysed per cell with a template-matching and threshold-crossing method (Axograph X, Berkeley, CA). Well-defined, isolated mEPSPs were identified and used to train a loose-fitting template, with a detection minimum threshold of 2.5 times the RMS baseline noise (Clements and Bekkers, 1997). Amplitudes and inter-event intervals were binned and their cumulative distribution compared using a Kolmogorov-Smirnov test.

Statistical analysis

Results are expressed as mean ± s.e.m. Student’s t-tests were used for statistical comparisons between groups, unless specified (ANOVA analyses, binomial test, Bonferroni post-tests, χ-squared test, Kruskal-Wallis test or K-S test) in the results or figure legends. p<0.05 indicates significant difference between groups (significance for comparisons: *p<0.05; **p<0.01; ***p<0.001). Sample sizes were chosen on the basis of previous studies. No statistical methods were used to predetermine the sample size.


  1. 1
  2. 2
  3. 3
    Upregulation of cAMP response element-mediated gene expression during experience-dependent plasticity in adult neocortex
    1. AL Barth
    2. M McKenna
    3. S Glazewski
    4. P Hill
    5. S Impey
    6. D Storm
    7. K Fox
    Journal of Neuroscience 20:4206–4216.
  4. 4
  5. 5
  6. 6
  7. 7
    V3 recombinants indicate a central role for CCR5 as a coreceptor in tissue infection by human immunodeficiency virus type 1
    1. SY Chan
    2. RF Speck
    3. C Power
    4. SL Gaffen
    5. B Chesebro
    6. MA Goldsmith
    Journal of Virology 73:2350–2358.
  8. 8
  9. 9
  10. 10
  11. 11
  12. 12
  13. 13
  14. 14
  15. 15
  16. 16
  17. 17
    A critical period for experience-dependent synaptic plasticity in rat barrel cortex
    1. K Fox
    Journal of Neuroscience 12:1826–1838.
  18. 18
  19. 19
  20. 20
    [HIV glycoprotein 120: possible etiological agent of AIDS-associated dementia]
    1. O Galicia
    2. M Sánchez-Alavez
    3. M Méndez Díaz
    4. L Navarro
    5. O Prospero-García
    Revista De Investigacion Clinica; Organo Del Hospital De Enfermedades De La Nutricion 54:437–452.
  21. 21
  22. 22
    Time course of experience-dependent synaptic potentiation and depression in barrel cortex of adolescent rats
    1. S Glazewski
    2. K Fox
    Journal of Neurophysiology 75:1714–1729.
  23. 23
  24. 24
  25. 25
    Cellular imaging of zif268 expression in the hippocampus and amygdala during contextual and cued fear memory retrieval: selective activation of hippocampal CA1 neurons during the recall of contextual memories
    1. J Hall
    2. KL Thomas
    3. BJ Everitt
    Journal of Neuroscience 21:2186–2193.
  26. 26
  27. 27
  28. 28
  29. 29
  30. 30
  31. 31
  32. 32
  33. 33
  34. 34
  35. 35
  36. 36
  37. 37
  38. 38
  39. 39
  40. 40
  41. 41
  42. 42
  43. 43
  44. 44
  45. 45
  46. 46
  47. 47
  48. 48
  49. 49
  50. 50
    Activation of ERK/MAP kinase in the amygdala is required for memory consolidation of pavlovian fear conditioning
    1. GE Schafe
    2. CM Atkins
    3. MW Swank
    4. EP Bauer
    5. JD Sweatt
    6. JE LeDoux
    Journal of Neuroscience 20:8177–8187.
  51. 51
  52. 52
  53. 53
  54. 54
  55. 55
  56. 56
  57. 57
  58. 58
  59. 59
  60. 60
  61. 61
  62. 62
  63. 63
  64. 64
  65. 65
  66. 66

Decision letter

  1. Moses V Chao
    Reviewing Editor; New York University Langone Medical Center, United States

In the interests of transparency, eLife includes the editorial decision letter and accompanying author responses. A lightly edited version of the letter sent to the authors after peer review is shown, indicating the most substantive concerns; minor comments are not usually included.

Thank you for submitting your article "CCR5 is a suppressor for cortical plasticity and hippocampal learning and memory" for consideration by eLife. Your article has been reviewed by three peer reviewers, and the evaluation has been overseen by a Reviewing Editor and a Senior Editor. The following individual involved in review of your submission has agreed to reveal his identity: Craig Curtis Garner (Reviewer #3).

The reviewers have discussed the reviews with one another and the Reviewing Editor has drafted this decision to help you prepare a revised submission.

The finding that a HIV co-receptor impacts upon learning and memory processes has implications for hippocampal function and may also be relevant to HIV-dementia. The three reviewers provided a number of very positive comments on the study of Ccr5 in hippocampal-dependent plasticity. The findings reported in the study were considered to be novel, interesting and well carried out. The use of overexpression and loss of function of Ccr5 was considered to be appropriate and supportive of the conclusions. It was suggested by the second reviewer that how Ccr5 has effects on excitatory synapses and upon pMAPK and pCREB levels be further considered. These points were brought up, as it is clear how Ccr5 mice with weaker excitatory synapses and lower release probability perform better. We believe you will be able to address these issues in a revised manuscript.

Reviewer #1:

This manuscript provides important insight into the role of chemokine receptor CCR5 as a suppressor of learning-related plasticity at the molecular, synaptic, and systems level. Traditionally, CCR5 has been studied as a chemokine receptor that mediates HIV cellular entry, and cognitive deficits in HIV infected individuals have been considered as a byproduct of neuroinflammation. In the present study, Zhou et al. use both loss-of-function (haploinsufficiency of Ccr5 heterozygote mice, shRNA mediated knockdown of Ccr5) and gain-of-function (Ccr5 overexpressing transgenic mice) approaches to show that CCR5 acts as a suppressor of neuroplasticity and memory, and that transgenic overexpression of CCR5 causes deficits in hippocampus-dependent contextual memory and neocortical experience-dependent plasticity. The authors further show that a single injection of HIV coat peptide that forms the ligand for CCR5 is sufficient to cause acute memory deficits that are prevented in Ccr5 null mice.

This is a very impressive and novel study that more than fulfills the criteria for an eLife publication. The study addresses the role of CCR5 in learning and memory using multiple approaches that support the overarching conclusion that CCR5 serves as a suppressor of plasticity and memory. I have no issues with the manuscript.

Reviewer #2 (General assessment and major comments (Required)):

Understanding the mechanisms that negatively regulate synaptic plasticity and memory processes is an important question. Zhou and colleagues report here that they have identified in a reverse genetic memory screen that hetero- and homozygotic KO mice lacking the GPCR Ccr5 exhibit enhanced memory in multiple memory tasks that involve the hippocampus, as shown here for fear conditioning and the Morris water maze. These behavioral changes are correlated with increased MAPK and CREB signaling following training as well as enhanced hippocampal LTP. In agreement with the hetero- and homozygotic KO data, Ccr5 knockdown in the adult hippocampus results in enhanced memory. Overexpression experiments support that Ccr5 acts in neurons to restrict memory processes. Complementary changes are observed in the barrel cortex, where Ccr5+/- mice or mice in which Ccr5 was knocked-down in neurons show enhanced responses to stimulation of a spared whisker, indicating increased experience-dependent plasticity. Recordings from pyramidal cells in layer 2/3 of the barrel cortex support enhanced LTP in these mice. Other physiological changes include lower release probability and smaller, less frequent mEPSPs in KO mice. Previous findings had shown that HIV coat proteins can bind and activate human CCR5, concomitant with the impaired cognition that can occur in HIV patients. The authors therefore tested acute effects of the gp120 V3 loop peptide on synaptic plasticity and memory processes in mice. They found that loss of Ccr5 or reduction of Ccr5 in hippocampal neurons protects against V3 peptide-induced LTP deficits and memory impairments. This is in agreement with a previous publication by Maung et al. (2014) that reports protection of Ccr5 KO mice against effects of a gp120 peptide. The results extend those findings by determining the timeline of peptide effects and by showing that Ccr5 acts in hippocampal neurons to mediate these effects.

This study reports interesting effects of Ccr5 on synaptic plasticity and memory processes, and presents data that MAPK and CREB signaling are altered upon loss or reduction of Ccr5. The experiments are convincing and allow for a comparison of effects of Ccr5 loss on hippocampal and cortical function. Yet, it remains unclear how Ccr5 functions as a regulator of plasticity and memory processes. Further, it remains open whether the gp120 V3 peptide impacts the same Ccr5-dependent mechanisms that modulate cognition. More detailed comments are provided below.

1) The experiments utilizing viral delivery support that Ccr5 acts in neurons, but the synaptic effects of Ccr5 are unclear. How can the authors explain that mice with weaker excitatory synapses and lower release probability can perform hippocampus-dependent tasks better? The idea of increased "headroom" to potentiate synapses is not compelling as it does not explain why Ccr5 is expressed in the brain if it simply acts to limit excitatory synapse properties. Also, it needs to be tested whether the lower mEPSC frequency in Ccr5 +/- mice is correlated with a reduction in excitatory synapse number. This is a possible alternative or additional cause for this mEPSC phenotype.

2) Through which mechanism can the GPCR Ccr5 impact MAPK and CREB signaling? Also, it is surprising that the activation of only a subset of neurons that occurs in the fear conditioning task is sufficient to substantially increase p-MAPK and p-CREB in total hippocampal homogenates of mice lacking Ccr5. Do the authors assume that the subset of activated Ccr5 +/- neurons undergoes such a massive increase in p-MAPK and p-CREB during learning that this change becomes detectable in total samples?

3) Does the gp120 V3 peptide alter MAPK and CREB signaling in a Ccr5-dependent manner? This will allow assessing to what extent this HIV peptide modulates the same mechanisms through which Ccr5 may restrict plasticity and learning.

4) The authors refer to the publication by Lee et al. (2009) that reports opposite effects of Ccr5 loss on cognitive functions. Yet, they do not discuss this beyond commenting that this is "likely due to genetic background effects". Lee et al. studied these mice in a mixed background while this work analyzes them in a C57BL/6N background. Yet, it is not clear why this difference is a "likely" explanation for this discrepancy. More compelling reasons need to be provided for the opposite phenotype of improved memory processes that is reported here and that is central to this study.

5) The finding that the effect on long-term memory after fear conditioning after shRNA knockdown in Figure 3E is higher than in the heterozygotic Ccr5 KO in Figure 1C and possibly higher than in the full KO in Figure 1—figure supplement 2 raises concerns about off-target effects. The authors can address this by testing whether delivery of Ccr5 shRNA causes effects in KO mice in one of the approaches presented here, e.g. the mEPSC recordings.

6) Does Ccr5 overexpression reduce p-MAPK and p-CREB levels? This would provide evidence that these signaling pathways are indeed linked to Ccr5 effects on neuronal function.

Reviewer #3:

Experiments presented in this study are designed to assess the role of C-C chemokine receptor 5 (CCR5) in learning and memory function. CCR5 is a GPCR involved in the inflammatory response. It is also expressed in CNS. Ligand (RANTES) binding to CCR5 modulates several signaling pathways implicated in learning and memory including adenylyl cyclase, PI3K/AKT and MAPK signaling. CCR5 is also involved in HIV infection. The antagonist maravirco has been found to improve cognition in HIV patents. In this current study, the authors have directly examined the contribution of CCR5 to hippocampal-dependent learning as well as experience-dependent plasticity in the barrel cortex.

Their data nicely shown that decreasing CCR5 function increases not only MAPK/CREB signaling but also LTP and hippocampal-dependent memory in CCR5 +/- and -/- mice. Conversely, over-expression of CCR5 results in memory deficit. In the barrel cortex, decreasing CCR5 enhanced spike timing dependent plasticity and accelerated experience-dependent plasticity. These data support the conclusion that CCR5 normally act to suppress plasticity and memory.

Overall the data presented are of very high quality and strongly support the author's claims. I am very impressed with this provocative study, which provides a strong case for the role of CCR5 as a potent suppressor of learning and memory function. The data presented are presented in a clear and logical manner and the discussion provides a balanced assessment of the database on the literature. The topic is well suited for the readership of eLife. I thus recommend publication without revision.


Author response

[…] Reviewer #2 (General assessment and major comments (Required)): […] This study reports interesting effects of Ccr5 on synaptic plasticity and memory processes, and presents data that MAPK and CREB signaling are altered upon loss or reduction of Ccr5. The experiments are convincing and allow for a comparison of effects of Ccr5 loss on hippocampal and cortical function. Yet, it remains unclear how Ccr5 functions as a regulator of plasticity and memory processes.

We respectfully disagree with the reviewer that we did not show “how Ccr5 functions as a regulator of plasticity and memory processes”. In our manuscript, we outline molecular (MAPK/CREB signaling), electrophysiological (LTP and probability of release), structural (spine counts), sensory plasticity and behavioral results that fully account for the function of CCR5 in the brain. Our results provide a large number of convergent and consistent results from multiple CCR5 manipulations (transgenic overexpression, viral knockdown, heterozygous and homozygous germ-line knockouts) that demonstrate the function of this receptor in plasticity and learning and memory. It is important that these results are consistent with a large amount of published data that implicate MAPK/CREB signaling and probability of release studies in plasticity and learning and memory.

Further, it remains open whether the gp120 V3 peptide impacts the same Ccr5-dependent mechanisms that modulate cognition.

The results in the paper address this question with electrophysiological (LTP) and learning and memory experiments, as well as new signaling experiments with Ccr5 knockdown or germ line knockouts. These studies demonstrated that the same mechanisms modulated by CCR5 (MAPK signaling, LTP and learning and memory) are affected by the gp120 V3 peptide. Together with published evidence, this provides strong evidence that the gp120 V3 peptide affects signaling, synaptic plasticity, and learning and memory mechanism modulated by CCR5.

More detailed comments are provided below.

1) The experiments utilizing viral delivery support that Ccr5 acts in neurons, but the synaptic effects of Ccr5 are unclear. How can the authors explain that mice with weaker excitatory synapses and lower release probability can perform hippocampus-dependent tasks better? The idea of increased "headroom" to potentiate synapses is not compelling as it does not explain why Ccr5 is expressed in the brain if it simply acts to limit excitatory synapse properties. Also, it needs to be tested whether the lower mEPSC frequency in Ccr5 +/- mice is correlated with a reduction in excitatory synapse number. This is a possible alternative or additional cause for this mEPSC phenotype.

The lower mEPSC frequency in Ccr5 heterozygous (Ccr5+/-) mice could arise from lower release probability or lower synapse number or both. The independent test of release rate using MK-801 shows that the release rate of Ccr5+/- mice is lower (Figure 7A, B). However, we have also addressed the possibility that synapse number could be lower in the Ccr5+/- mice by looking at dendritic spines on cortical layer 2/3 neurons (Author response image 1). We found that the cortical dendritic spine density of Ccr5 heterozygotes is very similar to that of their wild-type controls (Ccr5+/- mice: spine density = 1.021 spines per micron; wild-type mice: spine density = 1.026 spines per micron). Therefore, lower synapse number is unlikely to account for the lower mEPSC frequency.

Consistent with the finding in the cortex, analysis of spine density in the CA1 subregion of hippocampus in Ccr5+/- and wild-type mice also show that the dendritic spine density was similar between the wild-type and the Ccr5+/- mice (Figure 1—figure supplement 4D).

Compared to wild-type mice, the Ccr5+/- synapses have a lower release probability on average. However, there is a significant overlap between the distribution of synaptic strengths between mice with less CCR5 and controls. Consequently, many synapses will be just as strong in mice with CCR5 hypo-function as in their wild-type controls. However, the larger “reserve” of weaker release probability synapses in mice with less CCR5 results in a larger set of readily potentiate-able synapses that we believe are responsible for the increased LTP and for the higher learning speed of these mice. The CCR5 ligand RANTES has been shown to modulate glutamate release (Di Prisco et al., 2012; Merega et al., 2015; Musante et al., 2008). A role of RANTES in controlling glutamate release is consistent with our finding that release probability is lower in the Ccr5+/- mice. Again, we provide two lines of evidence for this: the MK-801 experiments (Figure 7 A, B) and measurements of mEPSC frequency (Figure 7E). We also showed that the lower mEPSC frequency is not due to lower synapse number (see Figure 1—figure supplement 4D).

We should also point out that there is precedent in the literature for the same association between low release probability, stronger LTP, faster sensory plasticity and enhanced learning and memory. Mice with a HRasG12V mutation show enhanced learning and memory, increased LTP, increased experience dependent sensory plasticity, and importantly, lower release probability (Kaneko et al., 2010; Kushner et al., 2005).

2) Through which mechanism can the GPCR Ccr5 impact MAPK and CREB signaling? Also, it is surprising that the activation of only a subset of neurons that occurs in the fear conditioning task is sufficient to substantially increase p-MAPK and p-CREB in total hippocampal homogenates of mice lacking Ccr5. Do the authors assume that the subset of activated Ccr5 +/- neurons undergoes such a massive increase in p-MAPK and p-CREB during learning that this change becomes detectable in total samples?

CCR5 is a G protein-coupled receptor (GPCR) that is both coupled to the Gαi and Gαq pathway upon activation by endogenous ligands (Blanpain et al., 2002; Mueller and Strange, 2004). Ligand binding to CCR5 modulates p44/42 MAPK signaling (Paruch et al., 2007; Tyner et al., 2005), and p44/42 MAPK can also regulate CCR5 expression (Li et al., 2009). Besides MAPK, CCR5 expression is also modulated by CREB signaling (Kuipers et al., 2008; Wierda and van den Elsen, 2012). Although we did not investigate directly this point in our manuscript, previous results suggest that CCR5 impacts CREB signaling through Gαi pathway and its downstream cAMP and PKA signaling pathways (Delghandi et al., 2005).

"it is surprising that the activation of only a subset of neurons that occurs in the fear conditioning task is sufficient to substantially increase p-MAPK and p-CREB in total hippocampal homogenates of mice lacking Ccr5."

Previous studies have shown that memories are allocated to only a subset of neurons in amygdala, hippocampus, and cortex (Cai et al., 2016; Han et al., 2007; Sano et al., 2014). Nevertheless, previous studies found significant overall increases in p-MAPK or p-CREB after learning (see for example, Atkins et al., 1998; Cammarota et al., 2000; Chen et al., 2012; Kushner et al., 2005). Consistent with previous published findings, we found that activation of a subset of neurons in Ccr5 knockout mice was sufficient to trigger an overall increase in p44/42 p-MAPK and p-CREB in hippocampal homogenates.

3) Does the gp120 V3 peptide alter MAPK and CREB signaling in a Ccr5-dependent manner? This will allow assessing to what extent this HIV peptide modulates the same mechanisms through which Ccr5 may restrict plasticity and learning.

To test whether V3 peptide modulates the same p44/42 MAPK or CREB mechanisms through which CCR5 suppresses plasticity and memory, we measured hippocampal p44/42 MAPK or CREB signaling after V3 peptide treatment and fear conditioning training (Figure 11). We found that treatment with V3 peptide resulted in reduced phospho- p44/42 MAPK (Figure 11B). Importantly, the V3-induced deficits in p44/42 MAPK signaling were ameliorated by Ccr5 knockdown in the hippocampus (Figure 11D). These results demonstrate a signaling mechanism (i.e., reduced phospho- p44/42 MAPK signaling) underlying the protective effect of Ccr5 knockdown in the V3 peptide induced plasticity and memory deficits.

4) The authors refer to the publication by Lee et al. (2009) that reports opposite effects of Ccr5 loss on cognitive functions. Yet, they do not discuss this beyond commenting that this is "likely due to genetic background effects". Lee et al. studied these mice in a mixed background while this work analyzes them in a C57BL/6N background. Yet, it is not clear why this difference is a "likely" explanation for this discrepancy. More compelling reasons need to be provided for the opposite phenotype of improved memory processes that is reported here and that is central to this study.

There are at least two important factors that could have contributed to the different results observed between the study by Lee et al. and ours: 1) In their behavioral studies, Lee et al. used F2 hybrid mice as controls (B6/129 PF2/J background) for their Ccr5-/- (B6J background) mice. There is an extensive literature demonstrating that to determine the effects of a mutation independently from other effects caused by genetic differences between mutants and controls, it is important that the mutant mice and their controls are in the same genetic background. For example, the hybrid mice used as controls in the Lee et al. study out-perform inbred mice, such as the B6J strain (genetic background of the Ccr5-/- mutants in the Lee et al. study), in learning tasks. We also found that in a fear conditioning task, B6/129 hybrid mice given very weak training (one 0.5mA shock) showed similar memory levels (Wiltgen and Silva, 2007) as the C57BL/6NTac mice in our study that received very strong training (3x0.75mA shocks) (Figure 1A, Figure 3E, and Figure 1—figure supplement 2A and B in our current study). In contrast to the Lee et al. study, we used wild type (WT) littermates as controls for the Ccr5-/- and Ccr5+/- mutant mice we studied. In our study, both WT controls and Ccr5 mice are in the same C57BL/6NTac background. 2) Additionally, Lee et al. used aged mice (12-18 month old) in their study, while we used adult mice (3-5 months old) for our experiments. Cell surface expression of CCR5 has been reported to change with age (Abraham et al., 2008), which may change the role of CCR5 in learning and memory during aging. We have modified our comment in the Discussion section as following "Although a previous study (Lee et al., 2009) reported learning and memory deficits in aged CCR5 mutants, this study used aged mice (12-18 month old) and the control mice with a different genetic background".

5) The finding that the effect on long-term memory after fear conditioning after shRNA knockdown in Figure 3E is higher than in the heterozygotic Ccr5 KO in Figure 1C and possibly higher than in the full KO in Figure 1—figure supplement 2 raises concerns about off-target effects. The authors can address this by testing whether delivery of Ccr5 shRNA causes effects in KO mice in one of the approaches presented here, e.g. the mEPSC recordings.

We respectfully disagree with the reviewer. It is not uncommon to observe a certain amount of variability in behavioral performance across experiments (which could be due to factors such as environment, season changes, different experimenters, etc.). Because of behavioral variability, in all of our experiments we always compared the manipulation studied (knockout, knockdown) with appropriate experimental cohort controls.

For example, in the fear conditioning figures (Author response image 2), we show here the 8 different fear conditioning experiments we have performed with mice with lower levels of CCR5. Although the levels of mouse freezing vary between experiments, the freezing levels of the shRNA experiment fall within this range, and importantly, Ccr5+/-, Ccr5-/-mice or mice with Ccr5 knockdown consistently showed enhanced memory when compared to their controls that were trained and tested at the same time. These results provide strong evidence that lowering Ccr5 levels result in enhanced learning and memory.

Author response image 2
Fear conditioning results of WT and Ccr5+/-, Ccr5-/- mice or mice with Ccr5 knockdown.

(A) Mice were tested 1 day after fear conditioning training. (B) Mice were tested 1 week after fear conditioning training. (C) Mice were tested 2 weeks after fear conditioning training. A dash line marking the freezing at 40% level was shown in the figures to help compare mouse freezing across different experiments.


6) Does Ccr5 overexpression reduce p-MAPK and p-CREB levels? This would provide evidence that these signaling pathways are indeed linked to Ccr5 effects on neuronal function.

Our results show that CCR5 transgenic mice that overexpress CCR5 in the excitatory neurons show decreased phospho-CREB levels 3 hours after fear conditioning training (Figure 4—figure supplement 3C; we found the opposite result in Ccr5 knockouts). Because of the critical role of CREB in memory consolidation (Bourtchuladze et al., 1994; Guzowski and McGaugh, 1997), this decrease in phospho-CREB accounts for the memory deficits of these transgenic mice.


Article and author information

Author details

  1. Miou Zhou

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    MZ, Conception and design, Acquisition of data, Analysis and interpretation of data, Drafting or revising the article
    Contributed equally with
    Stuart Greenhill
    Competing interests
    The authors declare that no competing interests exist.
  2. Stuart Greenhill

    1. Cardiff School of Biosciences, Cardiff University, Cardiff, United Kingdom
    2. School of Life and Health Sciences, Aston University, Birmingham, United Kingdom
    SG, Conception and design, Acquisition of data, Analysis and interpretation of data, Drafting or revising the article
    Contributed equally with
    Miou Zhou
    Competing interests
    The authors declare that no competing interests exist.
    ORCID icon 0000-0002-5038-5258
  3. Shan Huang

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    SH, Acquisition of data
    Competing interests
    The authors declare that no competing interests exist.
  4. Tawnie K Silva

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    TKS, Conception and design, Acquisition of data
    Competing interests
    The authors declare that no competing interests exist.
  5. Yoshitake Sano

    1. Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    2. Department of Applied Biological Science, Tokyo University of Science, Chiba, Japan
    YS, Acquisition of data
    Competing interests
    The authors declare that no competing interests exist.
  6. Shumin Wu

    Department of Molecular and Medical Pharmacology, University of California, Los Angeles, Los Angeles, United States
    SW, Acquisition of data
    Competing interests
    The authors declare that no competing interests exist.
  7. Ying Cai

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    YC, Acquisition of data
    Competing interests
    The authors declare that no competing interests exist.
  8. Yoshiko Nagaoka

    Department of Molecular and Medical Pharmacology, University of California, Los Angeles, Los Angeles, United States
    YN, Contributed unpublished essential data or reagents
    Competing interests
    The authors declare that no competing interests exist.
  9. Megha Sehgal

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    MS, Acquisition of data
    Competing interests
    The authors declare that no competing interests exist.
  10. Denise J Cai

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    DJC, Analysis and interpretation of data
    Competing interests
    The authors declare that no competing interests exist.
  11. Yong-Seok Lee

    1. Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    2. Department of Physiology, Seoul National University College of Medicine, Seoul, Republic of Korea
    Y-SL, Analysis and interpretation of data
    Competing interests
    The authors declare that no competing interests exist.
  12. Kevin Fox

    Cardiff School of Biosciences, Cardiff University, Cardiff, United Kingdom
    KF, Conception and design, Analysis and interpretation of data, Drafting or revising the article
    For correspondence
    Competing interests
    The authors declare that no competing interests exist.
  13. Alcino J Silva

    Departments of Neurobiology, Psychology, Psychiatry, Integrative Center for Learning and Memory and Brain Research Institute, University of California, Los Angeles, Los Angeles, United States
    AJS, Conception and design, Analysis and interpretation of data, Drafting or revising the article
    For correspondence
    Competing interests
    The authors declare that no competing interests exist.
    ORCID icon 0000-0002-1587-4558


National Institute of Mental Health (P50-MH0779720)

  • Kevin Fox
  • Alcino J Silva

Dr. Miriam and Sheldon G. Adelson Medical Research Foundation

  • Alcino J Silva

Medical Research Council (G0901299)

  • Kevin Fox

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.


We thank Ayal Lavi, Adam Frank, Michael Sofroniew, Yan Ao, and Kenta Saito for advice and technical support. We thank Antony Landreth, Anna Matynia, Mika Guzman, Cindy Montes, and Aida Amin for their contribution to the reverse genetic screen. This work was supported by grants from the NIMH (P50-MH0779720) to AJS and KDF, and from the MRC (G0901299) to KDF, and the Dr Miriam and Sheldon G Adelson Medical Research Foundation to AJS.


Animal experimentation: All experiments were performed during the light phase of the cycle. All studies were approved by the UCLA Institutional Animal Care and Use Committee, also known as the Chancellor's Animal Research Committee (ARC, protocol# 1998-070), and by University of Cardiff and carried out in compliance with the United Kingdom's Animals (Scientific Procedures) Act 1986 where applicable.

Reviewing Editor

  1. Moses V Chao, Reviewing Editor, New York University Langone Medical Center, United States

Publication history

  1. Received: August 26, 2016
  2. Accepted: December 19, 2016
  3. Accepted Manuscript published: December 20, 2016 (version 1)
  4. Version of Record published: January 5, 2017 (version 2)


© 2016, Zhou et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.


  • 1,650
    Page views
  • 434
  • 4

Article citation count generated by polling the highest count across the following sources: Scopus, PubMed Central, Crossref.

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Downloads (link to download the article as PDF)

Download citations (links to download the citations from this article in formats compatible with various reference manager tools)

Open citations (links to open the citations from this article in various online reference manager services)

Further reading

    1. Computational and Systems Biology
    2. Neuroscience
    Gautam Reddy et al.
    Research Article
    1. Neuroscience
    Kali Esancy et al.
    Research Article Updated