(A) Working model showing the cooperation between haemocyte-derived TNF and the immune response in the fat body in tumour cell death (Parisi et al., 2014). (B) RT-qPCR analyses showing expression of …
(A) Survival of defsk3 mutant flies (n = 53), upon Gram-positive, Listeria innocua infection, is compared to wild-type (wt) (n = 55) and spatzle (spzM7) (n = 30) (the Toll ligand) mutant flies. (B) …
(A-E’) Quantification of tumour volume (TV) (A) and tumour cell death (TCD) (B) in wing imaginal discs from dlg40.2 (n = 17), dlg40.2;defsk3 (n = 19) and dlg40.2;defsk4 (n = 20) mutant larvae and …
(A-E’) Quantification of TV (A) and tumour proliferation (B) from dlg40.2 (n = 19), dlg40.2;defsk3 (n = 16) and dlg40.2;defsk4 (n = 17) mutant larvae and representative pictures of the corresponding …
(A) RT-qPCR analysis of def expression in gut, fat body and trachea dissected from w1118 or dlg40.2 mutant larvae (n = 3). B-C, Fat body (B) and trachea (C) from dlg40.2 mutant larvae stained with …
(A-A’’) DAPI (blue), anti-Dcp1 (green) and anti-HA antibody (red) staining of dlg40.2 mutant tumour from larvae overexpressing a def-HA construct in the fat body and the trachea (dlg40.2;lpp >UAS-def…
(A-B) DAPI (blue) and anti-HA antibody (red) staining showing basal expression of Def-HA in trachea (A) but not in fat body (B) of UAS-def-HA larvae. C-D, DAPI (blue) and anti-HA antibody (red) …
(A) RT-qPCR analysis of def expression from dlg40.2 and dlg40.2;imd1 mutant larvae (n = 4). B-E’, Quantification of TV (B) and TCD (C) in wing imaginal discs from dlg40.2 (n = 15) and dlg40.2;imd1 …
(A) RT-qPCR analysis of def expression from dlg40.2 mutant larvae (dlg40.2;btl>) expressing a ctrl-IR or imd-IR in the trachea (n = 3). B-E’, Quantification of TV (B) and TCD (C) from dlg40.2 mutant …
(A-A’’) DAPI (blue), Annexin V (green) and anti-Def (red) staining of dlg40.2 mutant tumours. (B-B’’) Enlargement of inset from A’’ (white outline) showing Annexin V (B), Def (B’) and merged …
(A-B) DAPI (blue) and anti-HA antibody (red) staining showing expression of Def-HA in trachea (A) and fat body (B) of dlg40.2;egr3;lpp-gal4 >UAS def-HA larvae. C-C’, DAPI (blue), anti-Dcp1 (green) …
(A-C’) DAPI (white), anti-Dcp1 (red) and anti-Matrix metalloproteinase 1 (Mmp1, a reporter of JNK pathway activation, green) antibody staining of wing disc from dlg40.2, dlg40.2;defsk3 and dlg40.2;de…
(A-A’) DAPI (blue), anti-Dcp1 (red) and Annexin V (green) staining of scrib1 mutant tumours. (B-B’) DAPI (blue), anti-Dcp1 (red) and Annexin V (green) staining of egr3;scrib1 double mutant tumours. …
(A, B) Third instar larval imaginal wing disc overexpressing of hepwt using engrailed-gal4, UAS-rfp (eng>rfp; hepwt) (A; red). Discs where stained with AnnexinV to visualize PS exposure (B; green). …
Reagent type (species) or resource | Designation | Source or reference | Identifiers | Additional information |
---|---|---|---|---|
Genetic reagent (Drosophila melanogaster) | w1118 | (Dewey et al., 2004) | BDSC: 3605; RRID:BDSC_3605 | |
Genetic reagent (Drosophila melanogaster) | w1118 iso | (Ferreira et al., 2014) | N/A | |
Genetic reagent (Drosophila melanogaster) | dlg40.2/FM7 | (Mendoza-Topaz et al., 2008) | Flybase_FBal0240608 | |
Genetic reagent (Drosophila melanogaster) | FRT82B,scrib1/TM6 | (Bilder et al., 2000) | Flybase_FBal0103577 | |
Genetic reagent (Drosophila melanogaster) | egr3 | (Igaki et al., 2002) | Flybase_FBal0147163 | |
Genetic reagent (Drosophila melanogaster) | imd1 | (Leulier et al., 2000) | Flybase_ FBal0045906 | |
Genetic reagent (Drosophila melanogaster) | relE20 | (Leulier et al., 2000) | DGGR: 109927; RRID:DGGR_109927 | |
Genetic reagent (Drosophila melanogaster) | defsk3 | (Hanson et al., 2019) | N/A | |
Genetic reagent (Drosophila melanogaster) | defsk4 | (Hanson et al., 2019) | N/A | |
Genetic reagent (Drosophila melanogaster) | btl-gal4,UAS-RFP/CyO | Irene Miguel-Aliaga | N/A | |
Genetic reagent (Drosophila melanogaster) | lpp-gal4/TM6B | (Brankatschk and Eaton, 2010) | N/A | |
Genetic reagent (Drosophila melanogaster) | tub-gal4 | Bloomington Drosophila Stock Center | BDSC: 5138; RRID:BDSC_5138 | y(1) w[*]; P{w[+mC]=tubP-GAL4}LL7/TM3, Sb(4) Ser(1) |
Genetic reagent (Drosophila melanogaster) | hmlΔ-gal4,UAS-gfp | Bruno Lemaitre | N/A | |
Genetic reagent (Drosophila melanogaster) | en-gal4 | Bloomington Drosophila Stock Center | BDSC: 30564; RRID:BDSC_30564 | y1 w*; P{w + mW.hs=en2.4 GAL4}e16E |
Genetic reagent (Drosophila melanogaster) | UAS-def IR | Vienna Drosophila Resource Centre | VDRC: 102437; RRID:Flybase_FBst0474306 | P{KK111656}VIE-260B |
Genetic reagent (Drosophila melanogaster) | UAS-imd IR | Vienna Drosophila Resource Centre | VDRC: 101834; RRID:Flybase_FBst0473707 | P{KK109863}VIE-260B |
Genetic reagent (Drosophila melanogaster) | UAS-myd88 IR | Vienna Drosophila Resource Centre | VDRC: 25402; RRID:Flybase_FBst0455868 | w1118; P{GD9716}v25402 |
Genetic reagent (Drosophila melanogaster) | UAS-dlg IR | Vienna Drosophila Resource Centre | VDRC: 41136; RRID:Flybase_FBst0463952 | w1118; P{GD4689}v41136/TM3 |
Genetic reagent (Drosophila melanogaster) | UAS-egr IR | Vienna Drosophila Resource Centre | VDRC: 108814; RRID:Flybase_FBst0480608 | P{KK103432}VIE-260B |
Genetic reagent (Drosophila melanogaster) | UAS-w IR | Bloomington Drosophila Stock Center | BDSC: 25785; RRID:BDSC_25785 | y(1) v(1); P{y[+t7.7] v[+t1.8]=TRiP.JF01786}attP2 |
Genetic reagent (Drosophila melanogaster) | UAS-def | (Tzou et al., 2000) | Flybase_FBal0145092 | |
Genetic reagent (Drosophila melanogaster) | UAS-def-3xHA | FlyORF | FlyORF: F002467; RRID:Flybase_FBal0298643 | M{UAS-Def.ORF.3xHA.GW}ZH-86Fb |
Genetic reagent (Drosophila melanogaster) | UAS-dcr2 | Bloomington Drosophila Stock Center | BDSC: 24650; RRID:BDSC_24650 | w[1118]; P{w[+mC]=UAS-Dcr-2.D}2 |
Genetic reagent (Drosophila melanogaster) | spzM7 | (Neyen et al., 2014) | N/A | |
Antibody | Anti-GFP (Chicken polyclonal) | Abcam | Cat# ab13970; RRID:AB_300798 | IF(1:4000) |
Antibody | Anti-Def (Mouse polyclonal) | Dahua Chen (Ji et al., 2014) | N/A | IF(1:100) |
Antibody | Anti-HA (Mouse monoclonal) | Cell Signaling Technology | Cat# 2367, RRID:AB_10691311 | IF(1:1000) |
Antibody | Anti-dcp1 (Rabbit polyclonal) | Cell Signaling Technology | Cat# 9578, RRID:AB_2721060 | IF(1:100) |
Antibody | Anti-phospho-Histone H3 (Ser10) (Rabbit polyclonal) | Cell Signaling Technology | Cat# 9701, RRID:AB_331535 | IF(1:100) |
Antibody | Anti-phospho-Histone H3 (Ser28) (Rabbit polyclonal) | Cell Signaling Technology | Cat# 9713, RRID:AB_823532 | IF(1:100) |
Antibody | Anti-Mmp1 (Mouse clonality unknown) | Developmental Studies Hybridoma Bank | Cat# 3B8D12, RRID:AB_579781 | IF(1:10) |
Antibody | Anti-Chicken IgY Alexa 488 (Goat polyclonal) | Molecular Probes | Cat# A-11039, RRID:AB_142924 | IF(1:500) |
Antibody | Anti-Mouse IgG Alexa 488 (Goat polyclonal) | Molecular Probes | Cat# A-11029, RRID:AB_138404 | IF(1:500) |
Antibody | Anti-Mouse IgG Alexa 594 (Goat polyclonal) | Molecular Probes | Cat# A-11032, RRID:AB_141672 | IF(1:500) |
Antibody | Anti-Rabbit IgG Alexa 488 (Goat polyclonal) | Molecular Probes | Cat# A-11008, RRID:AB_143165 | IF(1:500) |
Antibody | Anti-Rabbit IgG Alexa 594 (Goat polyclonal) | Thermo Fischer Scientific | Cat# A-11037, RRID:AB_2534095 | IF(1:500) |
Sequence-based reagent | rpl32-fwd | This paper | PCR primers | AGGCCCAAGATCGTGAAGAA |
Sequence-based reagent | rpl32-rev | This paper | PCR primers | TGTGCACCAGGAACTTCTTGA |
Sequence-based reagent | def-fwd | This paper | PCR primers | CTTCGTTCTCGTGGCTATCG |
Sequence-based reagent | def-rev | This paper | PCR primers | ATCCTCATGCACCAGGACAT |
Sequence-based reagent | def-PCR-fwd | This paper | PCR primers | TTATTGCAGAAACGGGCTCT |
Sequence-based reagent | def-PCR-rev | This paper | PCR primers | ATGGTAAGTCGCTAACGCTAATG |
Sequence-based reagent | def-seq | This paper | Sequencing primers | CGTGTCTTCCTGCACAGAAA |
Sequence-based reagent | attA-fwd | This paper | PCR primers | ATGCTCGTTTGGATCTGACC |
Sequence-based reagent | attA-rev | This paper | PCR primers | TCAAAGAGGCACCATGACCAG |
Sequence-based reagent | cecA1-fwd | This paper | PCR primers | CTCAGACCTCACTGCAATAT |
Sequence-based reagent | cecA1-rev | This paper | PCR primers | CCAACGCGTTCGATTTTCTT |
Sequence-based reagent | dro-fwd | This paper | PCR primers | CGTTTTCCTGCTGCTTGCTT |
Sequence-based reagent | dro-rev | This paper | PCR primers | GGCAGCTTGAGTCAGGTGAT |
Sequence-based reagent | drs-fwd | This paper | PCR primers | CTCTTCGCTGTCCTGATGCT |
Sequence-based reagent | drs-rev | This paper | PCR primers | ACAGGTCTCGTTGTCCCAGA |
Peptide, recombinant protein | Drosophila endogenous Defensin | Bulet EIRL | N/A | |
Peptide, recombinant protein | Drosophila Synthetic Defensin | Genepep | N/A | ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN |
Commercial assay or kit | High Capacity cDNA Reverse Transcription Kit | Applied Biosystems | Cat# 4368813 | |
Commercial assay or kit | PerfeCTa SYBR Green FastMix (Low ROX) | Quanta Bio | Cat# 95074–012 | |
Commercial assay or kit | TRIzol Reagent | Thermo Fisher Scientific | Cat# 15596018 | |
Commercial assay or kit | Turbo DNA free Kit | Life Technologies LTD | Cat# AM1907 | |
Commercial assay or kit | High Capacity cDNA Reverse Transcription Kit | Applied Biosystems | Cat# 4368813 | |
Chemical compound, drug | 4′,6-Diamidine-2′-phenylindole dihydrochloride (DAPI) | Sigma | Cat# D9542 | 1 μg/mL |
Software, algorithm | Fiji | NIH | https://fiji.sc/ | |
Software, algorithm | GraphPad Prism 6 | GraphPad | RRID:SCR_002798 | |
Software, algorithm | 7500 Real-Time PCR Software | Applied Biosystems | RRID:SCR_014596 | |
Software, algorithm | BatchQuantify | (Johansson et al., 2019) | https://github.com/emltwc/2018-Cell-Stem-Cell | |
Software, algorithm | GraphPad Prism 6 | GraphPad | RRID:SCR_002798 | |
Software, algorithm | Volocity 3D Image Analysis Software | Perkin Elmer | RRID:SCR_002668 | |
Software, algorithm | ZEN two lite | Zeiss | RRID:SCR_013672 | |
Other | RNasine Plus RNase Inhibitor | Promega | Cat# N261 | |
Other | Vectashield mounting media | Vector Laboratories, Inc. | Cat# H-1000–10 | |
Other | Annexin V, Alexa Fluor 568 conjugate | Life Technologies LTD | Cat# A13202 | 1:20 |
Other | Annexin V, Alexa Fluor 488 conjugate | Life Technologies LTD | Cat# A13201 | 1:20 |
Other | Penicillin-Streptomycin (10,000 U/mL) | Thermo Fisher Scientific | Cat# 15140122 | Pen: 100 IU/mL Strep: 100 mg/mL |
Other | PfuUltra II Fusion HS DNA Polymerase | Agilent | Cat# 600670 | |
Other | AnnexinV binding buffer | Fisher Scientific | Cat# BDB556454 |