CELF RNA binding proteins promote axon regeneration in C. elegans and mammals through alternative splicing of Syntaxins

  1. Lizhen Chen
  2. Zhijie Liu
  3. Bing Zhou
  4. Chaoliang Wei
  5. Yu Zhou
  6. Michael G Rosenfeld
  7. Xiang-Dong Fu
  8. Andrew D Chisholm  Is a corresponding author
  9. Yishi Jin  Is a corresponding author
  1. University of California, San Diego, Division of Biological Sciences, United States
  2. Howard Hughes Medical Institute, University of California, United States
  3. University of California, San Diego, School of Medicine, United States

Abstract

Axon injury triggers dramatic changes in gene expression. While transcriptional regulation of injury-induced gene expression is widely studied, less is known about the roles of RNA binding proteins (RBPs) in post-transcriptional regulation during axon regeneration. In C. elegans the CELF (CUGBP and Etr-3 Like Factor) family RBP UNC-75 is required for axon regeneration. Using crosslinking immunoprecipitation coupled with deep sequencing (CLIP-seq) we identify a set of genes involved in synaptic transmission as mRNA targets of UNC-75. In particular, we show that UNC-75 regulates alternative splicing of two mRNA isoforms of the SNARE Syntaxin/unc-64. In C. elegans mutants lacking unc-75 or its targets, regenerating axons form growth cones, yet are deficient in extension. Extending these findings to mammalian axon regeneration, we show that mouse Celf2 expression is upregulated after peripheral nerve injury and that Celf2 mutant mice are defective in axon regeneration. Further, mRNAs for several Syntaxins show CELF2 dependent regulation. Our data delineate a post-transcriptional regulatory pathway with a conserved role in regenerative axon extension.

https://doi.org/10.7554/eLife.16072.001

eLife digest

Nerve cells or neurons carry information around the body along projections known as axons. An injury or trauma, such as a stroke, can damage the axons and lead to permanent disability because the damaged axons fail to regenerate over long distances.

Axon damage triggers large changes in the activity of many genes that promote regeneration. When a gene is active, its DNA is copied to make molecules of messenger RNA (mRNA), which are then used as templates to make proteins. Many mRNAs undergo a process called alternative splicing, in which different combinations of mRNA sections may be removed from the final molecule. This enables a single gene to produce more than one type of protein.

Recent studies point to an important role for so-called RNA binding proteins in regulating the alternative splicing process. An RNA binding protein called UNC-75 in a worm known as Caenorhabditis elegans has previously been shown to be involved in axon regeneration, but it was not clear how UNC-75 acts on neurons. Here, Chen et al. combined a technique called CLIP-seq (Cross-linking ImmunoPrecipitation-deep sequencing) with genetic testing to identify the mRNAs that UNC-75 regulates during axon regeneration.

The experiments found a set of C. elegans genes required for information to pass between neurons whose mRNAs are also targeted by UNC-75. Many of these genes are also required for axon regeneration. Chen et al. studied one of the mRNA targets – which encodes a protein called syntaxin – in more detail and found that the syntaxin mRNA is required for regenerating axons over long distances. UNC-75 alternatively splices this mRNA to produce a particular form of syntaxin that is mainly found in neurons. Mutant worms that lack either UNC-75 or syntaxin are unable to properly regenerate axons over long distances.

Further experiments show that a mouse protein known as CELF2 that is equivalent to worm UNC-75 plays a similar role in regenerating axons. Moreover, mouse CELF2 restores the ability of worm neurons that lack UNC-75 to regenerate. Like worm UNC-75, the mouse protein is also involved in alternative splicing of syntaxin. The next step is to examine the other mRNA targets of UNC-75 to find out what role they play in axon regeneration and other processes in neurons.

https://doi.org/10.7554/eLife.16072.002

Introduction

Axon regeneration requires coordinated gene expression at many levels (Benowitz et al., 1981; Gervasi et al., 2003; Glasgow et al., 1992; Skene and Willard, 1981). While much work has focused on injury-regulated gene transcription, increasing evidence points to roles for post-transcriptional regulation of mRNAs by RNA binding proteins (RBPs). In rodents, the Zipcode Binding Protein ZBP1 can bind axonal mRNAs and affect peripheral nerve regeneration via mRNA transport and decay (Donnelly et al., 2011). In Xenopus, hnRNP K binds mRNAs of growth-associated proteins such as GAP43 and NF-M and promotes protein synthesis in optic nerve regeneration (Liu et al., 2012). Recently, the conserved RNA 3’-terminal phosphate cyclase has been identified as an inhibitor of axon regeneration in C. elegans, Drosophila and mouse, acting through RNA repair and splicing (Kosmaczewski et al., 2015; Song et al., 2015). Despite these advances, mechanistic understanding of the roles of RBPs in axon regeneration remains limited.

CELF (CUG-BP and ETR-3-like Factor) family RNA binding proteins are highly conserved throughout animals (Dasgupta and Ladd, 2012). All six mammalian CELF proteins are expressed in the nervous system and several have been implicated in neuronal alternative splicing (Ladd, 2013). Analysis of Celf mutant mice has begun to reveal their roles in neuronal development and behavior (Dev et al., 2007; Dougherty et al., 2013; Kress et al., 2007; Wagnon et al., 2012; Yang et al., 2007). Celf4 deficient mice exhibit a seizure disorder (Wagnon et al., 2012; Yang et al., 2007), whereas Celf6 mutant mice display abnormal behaviors and reduced brain serotonin (Dougherty et al., 2013). However, CELF proteins have not previously been examined in the context of axon regeneration.

Here, we addressed the roles of CELF proteins in axon regeneration, focusing on C. elegans UNC-75 and mouse CELF2, both of which are localized to the nucleus (Loria et al., 2003; Otsuka et al., 2009). To identify direct targets of UNC-75 in C. elegans neurons we performed neuronal CLIP-seq to locate UNC-75 binding sites. Many UNC-75 target sites are in genes involved in synaptic transmission. We show that UNC-75 binding to an intronic site of UNC-64/Syntaxin promotes expression of neuronal UNC-64/Syntaxin isoforms. Loss of UNC-75 or of UNC-64 causes distinctive phenotypes in which regenerative growth cones are formed but are unable to extend. Overexpression of UNC-64 in unc-75 null mutants can rescue axon regeneration defects, indicating that UNC-64 is a major target of UNC-75 in regenerating neurons. Extending these findings to mammals, we find that mouse Celf2 expression is induced by axon injury and that CELF2 is required for effective peripheral axon regeneration. Furthermore, we identify multiple Syntaxin genes as CELF2 targets. Together, our data reveal a conserved pro-regeneration pathway operating at the level of alternative splicing.

Results

UNC-75/CELF functions cell autonomously in sensory and motor axon regeneration

PLM axon development was normal in all unc-75 mutants tested except that around 5% of PLMs lacked ventral synaptic branches. PLM axon regeneration in unc-75 mutants was reduced to 30–40% of wild type levels (Figure 1A,B). Interestingly, unc-75(md1344), a small deletion affecting the last exon encoding part of RRM3 and a nuclear localization signal (Figure 1—figure supplement 1A), displayed impairment in regrowth equivalent to the null mutants (Figure 1A,B). Transgenic animals expressing Pmec-4-GFP::UNC-75ΔNLS(aa 1–472) showed diffuse fluorescence throughout the cell, as compared to full-length GFP::UNC-75, which localizes to neuronal nuclei (Figure 1—figure supplement 1B) (Loria et al., 2003), suggesting that nuclear localization may be critical for UNC-75 function in axon regeneration. We further tested whether unc-75 affected regeneration of GABAergic motor neurons. In wild type, around 35% of DD2 commissures and 50% of VD4 commissures regrow to the dorsal cord by 24 hr after axotomy, whereas in unc-75 mutants fewer than 10% of commissures regrew to the dorsal cord (Figure 1E). Thus UNC-75 is critical for regenerative regrowth of multiple neuron types.

Figure 1 with 3 supplements see all
UNC-75 is required cell autonomously for axon regeneration.

(A) Images of regenerating PLM axons at 24 hr post axotomy; anterior is to the left and dorsal up. Red asterisk: PLM cell body; red arrow: injury site. (B) Quantitation of PLM axon regrowth 24 hr post laser axotomy, normalized to wild type. The unc-75 alleles md1309 and md1344 display defects in axon regrowth similar to e950. The unc-75(e950) PLM regrowth defect is rescued by multicopy and single copy unc-75(+) transgenes. Statistics: One-way ANOVA with Bonferroni post test. (C) unc-75(e950) animals showed reduced axon regrowth at all time points examined, and reduced growth rate 0–24 hr post axotomy. (D) Representative image series from time-lapse movies of the tip of a regenerating PLM axon from wild-type and unc-75(e950) animals starting at 14 hr post axotomy; see Video 1 and 2. Red and orange arrows point to the ends of regenerating axons at 14 and 15h post axotomy respectively. (E) unc-75(e950) is defective in regeneration of GABAergic motor neurons [marked by Punc-25-GFP(juIs76)]; this was rescued by Prgef-1-UNC-75 (juSi76). Images of GABAergic motor neuron commissures at 24 hr post axotomy. DD2 and VD4 were axotomized, and VD3 was uncut. Red arrowheads indicate the ends of regenerating or non-regenerating axons. Scale: 10 μm. Bar charts showing reduced regrowth of DD2 and VD4 neurons; N = 30–52.

https://doi.org/10.7554/eLife.16072.003

We rescued unc-75 PLM and motor axon regrowth defects with transgenes expressing UNC-75 under its own promoter, or with a single copy transgene expressing UNC-75 under the control of the pan-neuronal rgef-1 promoter (Figure 1A,B). Moreover, expression of UNC-75 using a touch neuron specific promoter (Pmec-4) fully rescued PLM regrowth, indicating that UNC-75 acts cell-autonomously (Figure 1A,B). Expression of UNC-75 in wild type animals did not enhance regrowth, indicating that UNC-75 is necessary but not sufficient to promote axon regeneration (Figure 1B). A mutant unc-75 cDNA lacking the NLS, expressed under its own promoter, failed to rescue behavioral defects of unc-75 mutant (Loria et al., 2003) and did not significantly rescue the regeneration defects (Figure 1—figure supplement 1C), supporting its function in the nucleus. In unc-75 mutant neurons the rate of axon extension was reduced at multiple time points after injury (Figure 1C), despite the presence of growth cones at the tip of the regrowing axons (Figure 1A). Using time-lapse imaging we found that wild-type PLM regenerative growth cones tended to be small and transient, and converted rapidly to elongating axons. In contrast, unc-75 mutants frequently displayed regenerative growth cones with dynamic filopodial protrusions, but these did not drive long-range axon extension (Figure 1—figure supplement 1D and Video 1,2). Indeed, we observed growth cones more frequently in non-regenerating PLM axons in unc-75 mutants than in the wild type (Figure 1—figure supplement 2), consistent with previous observations that presence of a growth cone does not correlate highly with axon extension (Chen et al., 2011; Edwards and Hammarlund, 2014). Injured motor axons in unc-75 mutants also formed regenerative growth cones that failed to extend (Figure 1E). Thus UNC-75 is required for regenerative axon extension but is either dispensable or a negative regulator of regenerative growth cone formation.

Video 1
Time-lapse movie of the tip of a regenerating PLM axon from a wild type animal, starting at 14 hr post axotomy, ending at 15 hr post axotomy.
https://doi.org/10.7554/eLife.16072.007
Video 2
Time-lapse movie of the tip of a regenerating PLM axon from an unc-75(e950) mutant, starting at 14 hr post axotomy, ending at 15 hr post axotomy.
https://doi.org/10.7554/eLife.16072.008

The C. elegans Elav-like RNA binding protein EXC-7 functions partially redundantly with UNC-75 in synaptic transmission (Loria et al., 2003), and co-regulates overlapping mRNA splicing events (Norris et al., 2014). exc-7 mutants displayed normal PLM axon regeneration, and unc-75 exc-7 double mutants resembled unc-75 single mutants in regeneration (Figure 1—figure supplement 3). fox-1/RBFOX, another known interactor of unc-75 in neuronal alternative splicing (Kuroyanagi et al., 2013a), is also not required for PLM regrowth (Chen et al., 2011). These observations suggest UNC-75 functions in axon regeneration non-redundantly with these known neuronal splicing regulators.

We next addressed how unc-75 interacted with the regrowth promoting MAP kinase kinase kinase DLK-1 and the regrowth inhibiting factor EFA-6. In C. elegans, PLM and motor neuron axon regeneration is completely blocked in null mutants of dlk-1 and is increased in animals overexpressing active DLK-1 (Yan and Jin, 2012). Double mutants unc-75(0); dlk-1(0) did not further reduce PLM axon regrowth compared to dlk-1(0), and the regrowing axons had no regenerative growth cones, resembling dlk-1(0) (Figure 1—figure supplement 2A,3B). Overexpression of DLK-1 in unc-75(0) partially improved regrowth compared to unc-75(0) single mutants (Figure 1—figure supplement 3C), suggesting that unc-75 and dlk-1 likely function in parallel. The conserved protein EFA-6 regulates axonal microtubule dynamics, and loss of EFA-6 strongly enhances PLM axon regrowth (Chen et al., 2011; 2015). efa-6(0) partially rescued unc-75(0) PLM regrowth defects (Figure 1—figure supplement 3C), but not the growth cone phenotype (Figure 1—figure supplement 2), suggesting that EFA-6 and UNC-75 function in parallel. Moreover, dlk-1 and efa-6 transcript levels were normal in unc-75 mutants (Figure 1—figure supplement 3D). Thus, these analyses suggest the UNC-75 axon extension pathway acts partly independently of the DLK-1 and EFA-6 axon regeneration regulators.

UNC-75 mRNA targets are enriched for genes involved in RNA binding and synaptic transmission

To dissect how UNC-75 regulates axon regeneration, we isolated RNAs bound by UNC-75 in neurons (Figure 2A). We expressed functional FLAG-tagged UNC-75 in neurons in unc-75(0) mutants, in which the locomotion defect was rescued by the FLAG::UNC-75 transgene (Figure 1—figure supplement 1D). We then performed crosslinking immunoprecipitation coupled with deep sequencing (CLIP-seq) (Figure 2—figure supplement 1A) (see Materials and methods). We used two methods to map the unique reads onto C. elegans genome (Figure 2A), and also manually inspected the genomic loci containing UNC-75 CLIP peak positions. We identified 533 functionally annotated protein-coding genes as UNC-75 targets (Supplementary file 1). 79% of the peaks in protein-coding genes were in intronic regions, and 21% in exons or UTRs, consistent with previous results implicating UNC-75 in alternative splicing (Kuroyanagi et al., 2013a; 2013b; Norris et al., 2014). We determined overrepresented motifs for UNC-75 binding (Figure 2B). The most enriched motif was UGUGUGUG, as exemplified by the binding site on unc-75 mRNA (Figure 2C), consistent with the UNC-75 binding site (G/U)UGUUGUG previously inferred from RNA-seq (Kuroyanagi et al., 2013b) and the U(G/A)UUGUG consensus motif defined by RNAcompete (Norris et al., 2014). The second most enriched motif G/CAAAAAA is not previously known, and is exemplified by nrx-1, a known UNC-75 target (Kuroyanagi et al., 2013b; Norris et al., 2014) (Figure 2C). The list of putative UNC-75 targets identified in our CLIP-seq analysis showed significant overlap with those identified in comparisons of whole-organism transcriptomes of wild type and unc-75 mutants (Kuroyanagi et al., 2013b; Norris et al., 2014) (Supplementary file 2). Such partial overlap is anticipated given the different techniques used (CLIP-seq of neuronal transcripts vs RNA-seq of the entire organism; see Discussion).

Figure 2 with 1 supplement see all
CLIP-seq of UNC-75 in C. elegans neurons.

(A) Flow chart of CLIP-seq analysis that identified 533 potential mRNA targets bound by UNC-75. (B) The top two motifs enriched in UNC-75 CLIP-seq peaks, based on MEME analysis of the sequence of bound mRNAs. (C) UNC-75 CLIP-seq peaks in unc-75, nrx-1, and unc-41, displayed using the UCSC Genome Browser. Splicing variants are shown under each genomic locus. Sequence of the annotated CIMS peak is shown next to the peak. 's' in peak number stands for 'substitution'. Red and blue tags indicate the two different gene orientation on chromosomes. Scale, 5 kb.

https://doi.org/10.7554/eLife.16072.009

When manually checking the genomic loci of UNC-75 targets, we observed that UNC-75 binding sites in introns often overlapped with regions that express snoRNAs. For example, peak s5644 (s stands for substitution of CIMS), located in an intron of unc-41, overlaps with the snoRNA C27H6.5 (Figure 2C). Although from the CLIP-seq data we cannot determine whether UNC-75 binds both mRNA and snoRNA, it is likely that UNC-75 at least binds to the mRNA, as the mapped reads included nucleotides outside the snoRNA.

We performed Gene Ontology (GO) analysis on the 533 potential protein coding targets of UNC-75 using DAVID (Huang da et al., 2008). The three most enriched functional annotation clusters are alternative splicing (49 genes, P = 3.9E-20, Fisher’s exact test), nucleotide-binding (60 genes, P = 4.5E-17) and transmembrane (66 genes, P = 2.2E-12), consistent with previously reported functions of UNC-75 in alternative splicing, and validating the quality of our CLIP-seq. The most significantly enriched signaling network is MAPK pathway (9 genes, P = 4.7E-3).

Having identified many mRNA targets bound by UNC-75, we sought targets involved in axon regeneration by taking advantage of our previous genetic screen (Chen et al., 2011). Among the 533 protein-coding target genes of UNC-75, we found 17 genes previously identified as required for axon regeneration (Supplementary file 2). GO analysis on these 17 genes resulted in the most significantly enriched cluster as cholinergic synaptic transmission (P = 1.6E-6, 4 genes including unc-32, unc-41, unc-64, unc-75 and unc-104). Mutants of these genes have normal PLM axon outgrowth in development and display significantly reduced PLM regrowth (Chen et al., 2011), yet their injured PLM axons were able to form regenerative growth cone-like structures more often than wild type axons (Figure 1—figure supplement 2). Thus, these synaptic transmission genes, like unc-75, appear to be specifically required for efficient regenerative axon extension.

UNC-75 promotes expression of a neuronal UNC-64/Syntaxin isoform, and represses a non-neuronal UNC-64/Syntaxin isoform

To understand how UNC-75 regulates its targets, we chose unc-64/Syntaxin for further study, as a prominent UNC-75 CLIP-seq peak mapped to the last intron (intron 7) of unc-64 (Figure 3A). Alternative splicing of unc-64 exons 8a and 8b, which flank intron 7b, generates transcripts encoding UNC-64A and UNC-64B isoforms, which differ in their C-terminal hydrophobic membrane anchors (Ogawa et al., 1998; Saifee et al., 1998). UNC-64A is expressed predominantly in neurons and in some non-neuronal tissues, whereas UNC-64B is only expressed in non-neuronal tissues (Saifee et al., 1998) (Figure 3B,C). RT-qPCR analyses showed that unc-64A mRNAs were significantly reduced in unc-75 mutants, whereas unc-64B mRNAs were increased (Figure 3—figure supplement 1A). Total unc-64 mRNA levels were reduced in unc-75 mutants compared to wild type, and expression of UNC-64 proteins in neurons was strongly reduced as determined by immunostaining using antibodies that recognize both isoforms (Figure 3—figure supplement 1B). Thus, UNC-75 is required for neuronal expression of UNC-64/Syntaxin isoforms.

Figure 3 with 3 supplements see all
UNC-75 regulates alternative splicing of unc-64/Syntaxin in neurons.

(A) UNC-75 CLIP-seq peaks in the unc-64 locus; genomic track display from UCSC Genome Browser. (B) In wild-type animals, UNC-64A::GFP is strongly expressed in most neurons. In unc-75(0) mutants UNC-64A::GFP is expressed at lower levels in most neurons. Images of nerve ring and head neurons. (C) UNC-64B::GFP is not expressed in the nervous system in wild-type background but is ectopically expressed in head neurons in unc-75(0). (D) Deletion of the 38 bp UNC-75 binding site in intron 7 results in neuronal expression of UNC-64B::GFP in wild-type background. (E) Images of anterior portion of animals expressing the UNC-64A/B splicing reporter in wild-type and unc-75(0) mutant backgrounds. unc-75(0) is e950. The splicing reporter contains the 3’ part of unc-64 genomic sequence (boxes are exon7, 8a and 8b, lines are intron 7a and 7b); RFP is inserted at the end of exon 8a and GFP inserted at the end of exon 8b. For B-E, scale bar 20 μm. Bar charts show quantitation of fluorescence intensity in the nerve ring region (ROIs shown in dashed boxes). Statistics: Student’s t-test. N=5–10.

https://doi.org/10.7554/eLife.16072.011

To dissect how UNC-75 differentially regulates the unc-64A and unc-64B isoforms we next examined unc-64 isoform-specific reporters, in which GFP was fused to exon 8a or exon 8b (Ogawa et al., 1998; Saifee et al., 1998). In unc-75 mutants expression of an UNC-64A::GFP reporter was strongly reduced (Figure 3B), whereas an UNC-64B::GFP reporter was ectopically expressed in the nervous system (Figure 3C). To define the roles of UNC-75 binding sites in this differential regulation, we then generated a neuronal splicing reporter for UNC-64A and UNC-64B, using unc-64 genomic DNA from exon 7 to exon 8b, with RFP inserted 3’ to exon 8a and GFP inserted 3’ to exon 8b (Figure 3E). In a wild type background, these transgenic animals expressed RFP strongly in the nervous system (UNC-64A-like expression), whereas GFP (reflecting the UNC-64B isoform) was undetectable. In unc-75 mutants, neuronal RFP expression was greatly reduced and GFP expression was increased in neurons (Figure 3E). Furthermore, deletion of the UNC-75 CLIP site in intron 7 of the splicing reporter increased UNC-64B::GFP expression in neurons and in non-neuronal tissues (Figure 3D). In addition, by RNA-seq, we detected significantly more reads mapping to intron 7a of unc-64 in unc-75 mutants, and fewer reads mapping to intron 7b compared to wild type (Figure 3—figure supplement 2). These analyses suggest UNC-75 binding in intron 7 promotes alternative splicing of exon 8a and represses inclusion of exon 8b through intron retention, resulting in neuronal expression of UNC-64A and repression of UNC-64B.

The two isoforms of UNC-64 are both localized to the plasma membrane via their transmembrane domains at the C terminus. A premature stop codon mutation (js116) in the UNC-64A transmembrane domain causes complete loss of function, indicating the importance of this domain (Saifee et al., 1998). Consistent with this, expression of UNC-64 lacking a transmembrane domain (UNC-64ΔTM) was unable to rescue the movement defect of unc-64(md130) (Figure 3—figure supplement 3), a partial loss of function (plf) allele affecting both isoforms (van Swinderen et al., 1999). We further expressed specific isoforms using cDNAs, and found that pan-neuronal expression of UNC-64A, but not of UNC-64B, was able to rescue the locomotion defects of unc-64(plf) (Figure 3—figure supplement 3). Thus UNC-64A appears to be the major functional Syntaxin isoform in neurons; even when ectopically expressed in neurons, as in unc-75 mutants, UNC-64B is unable to substitute for UNC-64A.

UNC-64 is specifically required for axon regeneration but not for axon development

Partial loss of function in unc-64 (md130 or e246) results in a partial block in PLM axon regeneration (Figure 4A). As unc-64(js115) null mutants arrest in the first larval stage (Saifee et al., 1998), we used two approaches to examine the null phenotype of unc-64 in regeneration. We first tested unc-64(js115) null mutants in which lethality, but not movement, was rescued by expression of UNC-64 under the combined control of acr-2, unc-17, and glr-1 promoters (Hammarlund et al., 2007). In such animals PLM developed normally and axon regeneration was inhibited to a similar extent as in unc-64(plf) (Figure 4A). To address caveats due to possible misexpression of this transgene in touch neurons, we also generated a single-copy transgene containing LoxP-flanked unc-64A(cDNA) driven by the pan-neural rgef-1 promoter, which fully rescued unc-64(0) lethality and locomotor defects (Figure 4B,C). We then excised the floxed copy of unc-64A(+) in touch neurons using Pmec-7-nCre (Chen et al., 2015). The unc-64(0) PLM axons developed normally (Figure 4—figure supplement 1) and displayed reduced regrowth after axotomy, comparable to unc-64(plf) (Figure 4A). We conclude that UNC-64 is specifically required for axon regeneration but not development, and that the null phenotype of unc-64 is a partial block in regeneration. Regenerative growth cones in unc-64(md130) mutants had dynamic filopodia but did not effectively elongate, resembling those of unc-75(0) (Video 3). Moreover, regrowth defects in unc-64(md130) were rescued by pan-neuronal expression of either UNC-64A or UNC-64B (Figure 4A), suggesting either isoform is sufficient for function in regeneration when overexpressed.

Figure 4 with 1 supplement see all
unc-64 is required cell autonomously for PLM axon regeneration.

(A) Normalized PLM regrowth 24 hr post axotomy. PLM axon regeneration is reduced in mutants with unc-64 partial loss of function alleles md130 and e246, as well as null allele js115. These alleles affect both isoforms (Saifee et al., 1998). unc-64(md130) regeneration phenotypes are rescued by pan-neural expression of UNC-64A or UNC-64B, but not by UNC-64∆TM. Expression of UNC-64A or B in a wild type background does not affect PLM regeneration. Statistics, One-way ANOVA followed by Bonferroni's Multiple Comparison Post Test. N ≥ 10. (B) Schematic illustration of two strategies to generate unc-64 mutation in touch neurons. The lethality of unc-64(js115) is rescued by oxEx705 or juSi316. juSi316 was crossed to Pmec-7-nCre to delete transgenic UNC-64 in touch neurons. (C) Representative images of animals with indicated genotypes. js115; oxEx705 animals were viable but severely Unc, while js115; juSi316 animals were viable and slightly Unc. (D) Representative PLM regrowth images 24 hr post axotomy. Asterisks: PLM cell body; red arrow, injury site. Scale bar: 100 μm.

https://doi.org/10.7554/eLife.16072.015
Video 3
Time-lapse movie of the tip of a regenerating PLM axon from an unc-64(md130) mutant, starting at 14 hr post axotomy, ending at 15 hr post axotomy.
https://doi.org/10.7554/eLife.16072.017

UNC-64A overexpression suppresses unc-75 axon regeneration and locomotion defects

To test the hypothesis that altered UNC-64 expression underlies the regeneration defects in unc-75 mutants, we overexpressed UNC-64 in unc-75 mutants and examined axon regrowth. Strikingly, transgenes containing unc-64 genomic DNA, which produce both UNC-64A and UNC-64B, significantly suppressed the PLM regeneration defects of unc-75 mutants (Figure 5A,B). Furthermore, pan-neuronal overexpression of UNC-64A (using cDNA), but not of UNC-64B, rescued unc-75 regeneration defects to a similar degree as unc-64 genomic DNA, whereas UNC-64ΔTM did not rescue (Figure 5A,B). Moreover, transgenes expressing unc-64 genomic DNA or UNC-64A strongly suppressed unc-75 locomotor phenotypes, while overexpression of UNC-64B or UNC-64ΔTM did not rescue (Figure 5C,D). We infer that decreased neuronal expression of the UNC-64A isoform is a major contributor to unc-75 mutant phenotypes in regeneration and behavior.

Overexpression of UNC-64A suppresses unc-75 neuronal phenotypes.

(A-B) Quantitation (n ≥ 10 per genotype) and images of PLM axon regeneration 24 hr post axotomy; scale, 10 μm. Asterisks: PLM cell body; red arrow, injury site. Transgenic UNC-64 expression using 9 kb genomic DNA encoding both UNC-64A and UNC-64B was able to partially rescue the regeneration defect of unc-75(0). Pan-neuronal expression of UNC-64A cDNA, but not UNC-64B, significantly increased axon regrowth in unc-75(0) mutants. (C-D) Quantitation of locomotion velocity and images of animals with indicated genotypes; scale, 0.5 mm. N ≥ 10 per genotype; statistics: One way ANOVA with Bonferroni post test. Genomic DNA or UNC-64A cDNA driven by Pan-neuronal promoter partially rescues the unc-75 locomotor phenotype; expression of UNC-64B or UNC-64ΔTM cDNA does not rescue. e950 is used in unc-75(0).

https://doi.org/10.7554/eLife.16072.018

CELF RBPs play a conserved role in axon regeneration

The CELF protein family is highly conserved from C. elegans to humans. By sequence comparison, UNC-75 is more closely related to the CELF3/4/5/6 subfamily (Figure 6—figure supplement 1A), and a previous study showed that expression of human CELF4 partly rescues the locomotion defects of unc-75 mutants (Loria et al., 2003). Here, we found that either mouse CELF2 or CELF4, when expressed in C. elegans touch neurons, could significantly rescue the unc-75 PLM regrowth defect, with CELF2 being slightly more effective than CELF4 (Figure 6A). This may be because CELF2, like UNC-75, is generally localized in the nucleus in neurons (Otsuka et al., 2009) whereas CELF4 is predominantly cytoplasmic (Wagnon et al., 2012). Nonetheless, this result suggests that the CELF proteins may also play a conserved role in axon regeneration.

Figure 6 with 1 supplement see all
CELF proteins play conserved roles in axon regeneration.

(A) Expression of full length cDNAs of mouse CELF2 or CELF4 with mCherry tag in C. elegans touch neurons significantly rescues the unc-75 axon regrowth defect. Normalized PLM axon regrowth 24 hr post axotomy, N = 14–28. Based on mCherry fluorescence the CELF2 and CELF4 transgenes are expressed at similar levels (not shown). (B) Celf2 transcript levels in DRG neurons decrease during postnatal development, whereas Celf4 levels increase. Expression was normalized to P1, and mouse β-Actin was used as internal reference. Statistics, One-way ANOVA followed by Bonferroni's Multiple Comparison Post Test. N = 4–6. (C) Expression of Celf2 transcripts in DRG of 2 month old mice is significantly enhanced 3 days after sciatic nerve injury. Ratio of the crushed side to the uncrushed side within the same animal is plotted. Statistics, Student’s t-Test. (D) Mutation of Celf2 impairs axon regeneration in DRG PV+ neurons. Confocal images of longitudinal sciatic nerve sections distal to the lesion, stained with anti-SCG10 (green) at 3 days post crush. tdTomato expression is from Rosa26-lox-STOP-lox-tdTomato and marks neurons in which Cre was active. Enlarged images of the boxed areas are shown on the right; white dashed line marks the lesion site. Scale bar: 0.5 mm. (E) Quantitation of SCG10 intensity in tdTomato positive axons at different distances from the lesion site, normalized to SCG10 intensity proximal to the lesion. 6 control and 5 mutant animals were analyzed. Statistics, One-way ANOVA followed by Bonferroni's multiple comparison post test.

https://doi.org/10.7554/eLife.16072.019

Among mouse Celf genes, Celf2 and Celf4 are most highly expressed in the postnatal CNS (Supplementary file 3). We further examined Celf2 and Celf4 expression in dorsal root ganglion (DRG) neurons using RT-qPCR. Celf4 transcripts increased during postnatal development (Figure 6B), consistent with reported expression (Supplementary file 3). In contrast, Celf2 mRNA levels declined from perinatal stages to adult (Figure 6B). Notably, Celf2 transcript levels significantly increased in DRGs after sciatic nerve crush in 2-month old animals (Figure 6C). As the peripheral processes of DRG neurons are capable of regeneration, and such capacity declines with age (Mar et al., 2014), the developmental decline in Celf2 expression and its upregulation after injury suggest Celf2 expression correlates with axon regeneration capacity.

CELF2 is required for sciatic nerve regeneration

To test the function of CELF2 in mouse axon regeneration, we generated a conditional allele of Celf2 in which exon 3 was flanked by loxP sites (Figure 6—figure supplement 1B). Exon 3 encodes part of RRM1, a domain present in most CELF2 isoforms and required for protein function (Singh et al., 2004). Cre-mediated deletion of exon 3 would alter splicing, resulting in Celf2 mRNA encoding non-functional CELF2 proteins due to frameshift followed by premature stop (Figure 6—figure supplement 1B). We expressed Cre recombinase ubiquitously in the Celf2flox background (see Materials and methods) to generate a Celf2- allele, and verified the genomic deletion of exon 3. These constitutive Celf2-/- mice died neonatally, with 5% escapers surviving up to 3 weeks. No obvious morphological defects were detected in newborn Celf2-/- animals by histological analysis (not shown). To test the role of Celf2 in axon growth, we assayed cultured primary neurons. Explants of DRG neurons derived from E13.5 Celf2-/- embryos displayed significantly reduced axon extension (Figure 6—figure supplement 1C,D). Thus although Celf2 does not seem to play a major role in developmental axon outgrowth, it is required for efficient regrowth of axons from explants.

To study CELF2 function in adult axon regeneration, we next generated a nervous system conditional knockout by crossing the Celf2(flox) allele to a Nestin-Cre line (Tronche et al., 1999). Nestin-Cre induced Celf2 knockout animals were smaller than littermates (Figure 6—figure supplement 1E) and usually survived 1–2 months. Using an in vitro regeneration assay (Saijilafu and Zhou, 2012), we found Celf2 knockout neurons showed defects in adult DRG regeneration after re-suspension and re-plating of DRG cells (Figure 6—figure supplement 1F,G). To examine in vivo regeneration, we crossed Celf2flox allele to a Parvalbumin-Cre driver to delete Celf2 in parvalbumin-expressing large diameter DRG neurons, which make up ~30% of DRG axons (Hippenmeyer et al., 2005). Celf2flox/-; parvalbumin-cre+/- mice were superficially wild-type, allowing us to examine axon regeneration in adult stages. We used R26/CAGtdTomato (Madisen et al., 2010) to label cells with Cre induced Celf2 deletion. We performed sciatic nerve crush on 2 months old animals and evaluated DRG axon regeneration 3 days post injury by staining for the regeneration marker SCG10 (Shin et al., 2014). SCG10 positive DRG axons distal to the crush site were significantly reduced in the Celf2 mutant compared to littermate controls (Figure 6C,D), indicating that CELF2 is required for DRG axon regeneration. Together, these data support a conclusion that CELF proteins play a conserved role in axon regeneration from C. elegans to mouse.

CELF2 can regulate expression of multiple Syntaxins

CELF2 is known as a splicing regulator, but its role in the nervous system has not been explored. To test whether CELF2 regulates similar sets of target mRNAs as UNC-75, we performed CLIP-seq of mouse CELF2 using a neuroblastoma N2A cell line (http://www.atcc.org/products/all/CCL-131.aspx#generalinformation) that stably expresses BLRP (biotin ligase recognition peptide) tagged CELF2 (Figure 2—figure supplement 1B). We identified 2919 protein coding genes as CELF2 targets (Supplementary file 4) and 'UGUGUGUG' as the most significant binding motif, which is conserved to UNC-75, suggesting the function of CELF genes in target regulation is highly conserved.

As C. elegans UNC-75/CELF regulates UNC-64/Syntaxin alternative splicing, we asked whether CELF-Syntaxin regulation might be conserved in mammals. From CELF2 CLIP-seq we identified CELF2 binding sites in multiple mouse Syntaxin genes (Figure 7A and Supplementary file 4). We examined expression of candidate Syntaxin genes in Celf2 knockout mouse brain by RT-qPCR, and observed that mRNA levels of splicing variants of Syntaxin2 and Syntaxin16 were significantly altered in Celf2-/- mouse brain (Figure 7B). Syntaxin2 is ubiquitously expressed (Bennett et al., 1993), but its role in the nervous system is not known. Reminiscent of unc-64, Syntaxin2 is alternatively spliced, generating two isoforms differing in the C-terminal membrane anchor. From CLIP-seq we found a CELF2 binding site in the intron 5’ to the alternatively spliced exons (Figure 7A). Syntaxin16 expression is enriched in neurons in the brain and has been implicated in neurite growth (Chua and Tang, 2008). Two splicing variants of Syntaxin16 differ in exons encoding the N terminus, which is known to interact with Vps45 (Dulubova et al., 2003). We detected CELF2 binding on the introns in the immediate vicinity to the alternatively spliced exons, as well as on the 3’ UTR (Figure 7A). Taken together, these data support a hypothesis that CELF-mediated regulation of alternative splicing of Syntaxin genes is likely a conserved mechanism in axon regeneration.

CELF2 regulates expression of specific neuronal Syntaxin isoforms.

(A) Genome browser tracks displaying CELF2 CLIP-seq peaks on the stx2 and stx16 gene loci. Red and blue tags indicate the two different gene orientation on chromosomes. CELF2 binding peaks are mapped to introns near alternatively spliced exons. Isoform labeling is consistent to gene annotation on Ensembl. Red arrows under the exons implicate primers used for RT-qPCR in panel b. (B) Transcript levels of Syntaxin genes were measured by RT-qPCR in E15.5 control and Celf2-/- brains. Statistics, Student’s t-test, N = 5–6. Expression of the alternatively spliced isoform 002 of stx2 and isoform 001 of stx16 was significantly decreased in Celf2-/- constitutive mutants.

https://doi.org/10.7554/eLife.16072.021

Discussion

We have shown that CELF RNA-binding proteins play conserved roles in axon regeneration from C. elegans to mammals. Using genomic approaches we identify synaptic transmission genes as key CELF targets. Expression of neuronal Syntaxins is regulated by CELF-mediated alternative splicing and is critical for regeneration. The CELF/Syntaxin pathway is not required for regenerative growth cones to form but allows them to efficiently extend axons. We propose that post-transcriptional regulation by CELF balances the production of mRNA and protein isoforms during axonal regeneration.

UNC-75 targets in C. elegans neurons

CELF proteins are long known as regulators of RNA splicing and stability, but their roles in neuronal RNA regulation are only recently being explored. Our findings, together with previous RNA-seq analyses, identify contexts in which UNC-75/CELF regulates alternative splicing for inclusion of neuron-specific exons in C. elegans. The production of neuronal mRNA encoding unc-32/ATPase depends on alternative splicing of two sets of mutually exclusive exons, which involves UNC-75 binding to their flanking introns, partly in collaboration with the RBPs ASD-1 and FOX-1 (Kuroyanagi et al., 2013a). Motor neuron subtype alternative splicing of unc-16/JIP3 mRNA also involves UNC-75 binding to intron sequences, and the outcome of exon inclusion or exclusion partly depends on the Elav-like RBP EXC-7 in cholinergic neurons (Norris et al., 2014). These previous studies were based on comparisons of whole-organism RNA levels, which reflect both direct and indirect regulation by UNC-75. As neurons contribute a small fraction of the overall C. elegans transcriptome, many neuronal targets of UNC-75 may have been overlooked in such studies. Our use of neuronal CLIP-seq validates some previous targets as direct interactors of UNC-75 and has expanded the number of candidate targets by an order of magnitude.

Many of UNC-75’s neuronal targets are involved in synaptic transmission, and were also identified as required for axon regeneration (Chen et al., 2011). The close similarity between unc-75 and unc-64 regeneration phenotypes, and the ability of UNC-64 overexpression to rescue unc-75 defects suggest that they act in a common pathway for regenerative axon extension. We therefore focused on how UNC-75 mechanistically promotes UNC-64 expression. Our analysis shows that UNC-75 binding to intron 7b promotes inclusion of the upstream exon 8a, leading to production of UNC-64A at the expense of UNC-64B. These results support the general model that UNC-75 tends to promote inclusion of upstream exons by binding downstream intronic sites (Kuroyanagi et al., 2013b; Norris et al., 2014). Loss of UNC-75 caused increased pre-mRNA containing unc-64 intron 7a and decreased pre-mRNA containing intron 7b, suggesting that alternative splicing of unc-64 is regulated via selective intron retention. In unc-75 mutants, we detected reduced UNC-64A::GFP expression from our reporter line (Punc-64-unc-64A::gfp), although the reporter lacked intron 7b (Figure 3B). The reduction of UNC-64A expression from this reporter was not as dramatic as that from the dual reporter containing intron 7b (Figure 3E). We speculate that if the primary binding site is not available (i.e. intron 7b), UNC-75 can bind to secondary sites (e.g. intron 7a) to regulate UNC-64A expression. Consistent with this idea, we detected UNC-75 binding tags from our CLIP-seq in intron 7a (Figure 3A).

Functions and targets of CELF2 in neurons

CELF2 was identified almost 20 years ago, in multiple studies, first as a CUG repeat binding protein CUG-BP2 (Timchenko et al., 1996); in screens for homologs of the Elav family (ETR-3) (Lu et al., 1999); and as a gene induced in apoptotic neuroblastoma cells (NAPOR) (Choi et al., 1998). However until now, in vivo functions of CELF2 have not been explored using genetics. We find that CELF2 is essential for viability. The cellular basis of the lethal phenotype remains to be determined, but may reflect CELF2 functions in non-neuronal cells, as animals with a neuronal deletion of CELF2 were viable, albeit smaller and short-lived compared to wild type.

Alternative splicing (AS) is pervasive in neurons and has been implicated in axon guidance, synaptogenesis and synaptic transmission (Raj and Blencowe, 2015). The function of CELF family members in AS was first explored in non-neuronal cells (e.g. cardiomyocytes), but given their widespread expression in the brain increasing attention has been given to the neuronal roles of CELF proteins (Ladd, 2013). CELF4 appears to be predominantly expressed in the cytoplasm of neurons and is implicated in neuronal excitability (Wagnon et al., 2012; Yang et al., 2007). A CELF4 CLIP-seq analysis in mouse brain identified numerous targets, including many genes implicated in synaptic transmission, although CELF4 is thought to primarily regulate mRNA translation (Wagnon et al., 2012). CELF2 is known to regulate the AS of specific neuronal genes, including NMDAR1, MAPT/tau, and NF1 (Barron et al., 2010; Han and Cooper, 2005; Leroy et al., 2006). Screens for CELF2 targets have been performed using SELEX (Faustino and Cooper, 2005) and by CELF2 overexpression in T-cells (Mallory et al., 2015). Here we report a genome-wide CLIP-seq approach to find CELF2 targets in neuronal cells. Consistent with our analysis of UNC-75 neuronal targets, in neuroblastoma cells, CELF2 binding sites were found in several Syntaxin genes. Like UNC-64, several mammalian Syntaxins are known to undergo alternative splicing, and we find that expression of two Syntaxin isoforms (stx2-002 and stx16-001) is significantly reduced in Celf2 mutant brains.

Regulation of CELF expression and function

We find that CELF2 expression is upregulated after nerve injury. Expression of CELF2 or other CELF genes is altered by cellular stress or damage in several contexts, although the mechanisms of induction remain poorly understood. In epithelial cells CELF2 expression is induced by UV or gamma irradiation injury (Mukhopadhyay et al., 2003). In the nervous system CELF1 has been reported to be upregulated after spinal cord injury (Yang et al., 2015). CELF2 expression is also downregulated in some models of ischemic brain injury and fetal alcohol syndrome, although it is unclear whether this is cause or consequence (Otsuka et al., 2009). Acute induction of CELF2 expression has been most extensively studied during T cell activation, and occurs partly at the level of transcription and partly by stabilization of Celf2 transcripts (Mallory et al., 2011; 2015). Recently CELF2 has been found to regulate alternative splicing of the MAPKK MKK7, facilitating a JNK-dependent positive feedback loop during T cell activation (Martinez et al., 2015). JNK is required for the increased stability of CELF2 messages after T cell activation, by as-yet unknown mechanisms. Many targets of JNK-regulated AS are also dependent on CELF2 (Martinez et al., 2015), suggesting the CELF2/JNK positive feedback loop might function widely to regulate inducible alternative splicing.

Syntaxin isoforms and synaptic transmission genes function in axon extension

UNC-75 dependent splicing is critical for UNC-64A expression in neurons, at the expense of UNC-64B. The roles of the two UNC-64 isoforms and the mechanistic basis for their functional difference have remained a topic of debate. As truncation of UNC-64A causes apparent complete loss of function (Saifee et al., 1998), UNC-64A appears to be the predominant functional isoform in neurons. Overexpression of either A or B isoform rescued the axon regrowth defect of unc-64 hypomorphs, but only the A isoform was sufficient to rescue unc-64 locomotor defects when overexpressed. The level of UNC-64 function required in regeneration may be lower than in behavior. A recent study also reported unc-64 splicing is regulated by unc-75 (Norris et al., 2014). However, using fosmid transgenes, this study found that while either A or B isoform could rescue unc-64 Ric phenotypes, only UNC-64B could rescue unc-64 locomotor phenotypes. The basis for this discrepancy might reflect differences in the promoters and nature of expression (pan-neural and cDNA in our study, endogenous regulatory sequences including splicing of 5’ exons in Norris et al.). We find that transgenic expression of UNC-64A (cDNA bypassing splicing) also significantly suppressed unc-75 locomotor and regeneration phenotypes whereas overexpression of UNC-64B was unable to rescue. The simplest interpretation of these data is that UNC-64B is unable to fully substitute for reduced levels of UNC-64A. Possibly, UNC-64B but not UNC-64A requires some additional cofactor lacking in unc-75.

The C-terminal membrane anchors of UNC-64A and B are both 25 aa residues long and differ only in the last 14 aa, suggesting that the precise composition of the anchor is critical for Syntaxin function. Both have the same number of hydrophobic residues in their C-termini, with the only discernible difference being that these residues are more clustered in the B isoform. Nevertheless seemingly small differences in hydrophobicity can cause Syntaxins to sort into distinct membrane domains (Milovanovic et al., 2015; Milovanovic and Jahn, 2015), and may underlie the nonequivalence of the UNC-64A and B isoforms.

UNC-64 is known to localize along the axonal plasma membrane, and may provide a SNARE function involved in membrane addition during axon extension. Like unc-64, Syntaxin2 encodes two alternatively spliced isoforms that differ in the membrane anchor. Syntaxin2 (also called epimorphin) was first identified as an extracellular morphogen (Hirai et al., 1992), but later was also found to function in the cytoplasm as t-SNARE regulating vesicle fusion (Bennett et al., 1993). The localization of this protein on either the cytoplasmic face or the extracellular surface of the plasma membrane is determined by its distinct conformation (Chen et al., 2009). Little is known of the neuronal functions of Syntaxin2. In mammals Syntaxin16 has been implicated in neurite outgrowth, and appears to localize to the Golgi (Chua and Tang, 2008). Mammalian Syntaxin12 (previously called Syntaxin13) has been shown to promote axon regeneration under the control of the mTOR pathway (Cho et al., 2014). Whether other Syntaxins also play a role in axon regeneration remains to be tested.

The mechanism by which Syntaxin contributes to regenerative axonal elongation remains to be elucidated. Because unc-64 mutants are defective in axon extension rather than growth cone reformation, we believe it is less likely that Syntaxin is required for membrane resealing immediately after injury. Instead, Syntaxin may contribute to the rapid plasma membrane expansion required during axon regrowth (Bloom and Morgan, 2011). In mammalian neurons Syntaxin-3 has been implicated in fatty acid stimulated axon plasma membrane expansion resulting from fusion of transport organelles (Darios and Davletov, 2006). Such organelles might be related to the Syntaxin-containing transport packets involved in presynaptic assembly (Ahmari et al., 2000). The recycling endosome component Syntaxin13 is upregulated by injury and is thought to promote membrane recycling required for regrowth (Cho et al., 2014). Finally, Syntaxin might contribute to membrane expansion via a non-fusogenic mechanism as shown for the SNARE Sec22b (Petkovic et al., 2014).

In summary, we have revealed a novel regulatory pathway important for axon extension in regenerative regrowth, involving CELF-dependent alternative splicing of neuronal Syntaxins. As well as being relevant to axon regeneration, our finding may shed light on the roles of CELFs in neurological disease. CELF2 is misregulated in a mouse model of spinal muscular atrophy (Anderson et al., 2004) and CELF2 copy-number variation has been linked to schizophrenia (Xu et al., 2011). Our results add to the conceptual framework for dissecting these complex diseases.

Materials and methods

C. elegans genetics, molecular biology and transgenes

Request a detailed protocol

C. elegans were cultured at 15–25°C using standard procedures. Transgenes were introduced into mutants by crossing or injection; homozygosity for all mutations was confirmed by PCR or sequencing. We followed standard procedures to generate new clones and transgenes (All new strains and transgenes are listed in Supplementary file 5).

Fluorescence microscopy and laser axotomy

Request a detailed protocol

Fluorescence images were collected using Zeiss LSM710 or LSM510 confocal microscopes. Laser axotomy was performed as previously described (Chen et al., 2011). Raw (non normalized) axon regrowth measurements are show in Supplementary file 7.

Timelapse movies of PLM axon regrowth were taken with Zeiss LSM710 using agarose beads to immobilize worms. Immunostaining was performed as described (Saifee et al., 1998). Briefly, worms were fixed in Bouin’s fixative and washed in fresh BTB buffer (1 x Borate Buffer, 0.5% Triton X-100, 2% BME), then stained with UNC-64 antiserum at 1:50 dilution.

Locomotion analysis

Request a detailed protocol

We measured locomotion velocity using WormTracker 2.0 as previously described (Chen et al., 2015). Briefly, individual young adults were transferred to a fresh tracking plate with thin OP50 bacteria lawn. 1 min later, the plate was placed on the tracker platform and locomotion recorded for 1 min at 10 frames per second for each animal.

Crosslinking Immunoprecipitation and deep sequencing (CLIP-seq) in C. elegans

Request a detailed protocol

CLIP-seq was performed as previously described (Zisoulis et al., 2010). CZ14662 [unc-75(e950); Prgef-1-UNC-75S(juIs369)] worms were crosslinked in a 150 mm plate (with no food) with an energy output of 6 kJ/m2. Worms were lysed by sonication in Homogenization Buffer (100 mM NaCl, 25 mM HEPES, 250 μM EDTA, 2 mM DTT, 0.1% NP-40, 25 units/ml RNasin and Protease Inhibitors). Lysates were centrifuged at 16,000g for 15 min at 4°C and supernatants collected and incubated with M2 magnetic beads (Sigma) overnight on a rotator.

Beads were collected and washed twice with Wash Buffer (1X PBS with 0.1% SDS, 0.5% sodium deoxycholate, and 0.5% NP-40), twice with High Salt Wash Buffer (5X PBS, 0.1% SDS, 0.5% sodium deoxycholate, and 0.5% NP-40) and twice with Polynucleotide Kinase Buffer (PNK Buffer) (50 mM Tris-Cl pH 7.4, 10 mM MgCl2 and 0.5% NP-40). Beads were incubated with 500 μl of Micrococcal Nuclease Reaction Buffer (50 mM Tris-Cl pH 7.9, 5 mM CaCl2) containing 1 ng of Micrococcal Nuclease (NEB) for a total of 10 min at 4°C with intermittent shaking on a Thermomixer (Eppendorf) (1200 rpm for 1 min and then 1200 rpm for 15 sec every 3 min). Beads were then washed twice with PNK+EGTA Buffer (50 mM Tris-Cl pH 7.4, 20 mM EGTA and 0.5% NP-40), twice with Wash Buffer and twice with PNK Buffer. The beads were incubated for 10 min at 37°C in the Thermomixer with intermittent shaking (1200 rpm for 15 sec every 3 min) in 80 μl NEB Buffer 3 containing 30 units of Calf Intestinal Phosphatase (NEB). The beads were then washed twice with PNK+EGTA Buffer, twice with PNK Buffer and twice with 0.1 mg/ml BSA. An RNA linker (5'- CUCGUAUGCCGUCUUCUGCUUG-3’ 3’ Puromycin, 5’P) with a puromycin modification at the 3′ end to avoid self-circularization was linked to the mRNA present in the complexes by T4 RNA Ligase and incubated overnight at 16°C with gentle shaking (1300 rpm every 5 min for 15 s in the Thermomixer). The beads were washed three times with PNK Buffer and incubated in 80 μl PNK Buffer (NEB) with 40 units of T4 PNK enzyme (NEB) in the presence of 32P-γ-ATP (1 mCi). Samples were incubated for 10 min at 37°C with intermittent shaking (1000 rpm every 4 min for 15 s). Cold ATP was added to the reaction at a final concentration of 1.25 mM and incubated for 5 min. The reaction was terminated with three washes of PNK+EGTA Buffer. Complexes were eluted from the beads by incubation for 10 min at 70°C in Nupage LDS Buffer. Samples were loaded onto a native 10% Bis-Tris gel with MOPS SDS Running Buffer. Next, the samples were transferred to a nitrocellulose membrane. The band corresponding to UNC-75/RNA complexes (65–100 kDa) was cut out of the membrane and proteins degraded by Proteinase K. The samples were then subjected to phenol/chloroform extraction followed by ethanol precipitation. RNA was resuspended and ligated to 5′ RNA Linker (5'-GCUGAUGCUACGACCACAGGNNNU-3' 3'OH, 5'OH) with T4 RNA ligase at 16°C overnight. The RNA samples were then treated with DNase I followed by phenol/chloroform extraction and ethanol precipitation. The ligated RNA was reverse transcribed with P3 primer (5’-CAAGCAGAAGACGGCATACGAG-3’) followed by PCR. PCR primers 5’-CAAGCAGAAGACGGCATACGAG and 5’-GCTGATGCTACGACCACAGG-3’ were used. PCR product was analyzed on PAGE gel, bands corresponding to 75–150 nt were isolated and the DNA was extracted for sequencing.

52,415,296 total reads were obtained, among which 22,399,451 were mapped to the C. elegans genome (ce10). After removing PCR duplicates and non-unique reads, 688,276 unique reads were obtained. From these unique reads, overlapping CLIP tags were grouped to define CLIP peaks. We identified 1219 peaks distributed over 820 protein-coding genes, among which 410 genes are annotated with gene names (e.g. scpl-1), the remaining 410 genes being listed by sequence names (e.g. Y106G6D.8) (Supplementary file 1). Crosslinking induced mutation sites (CIMS) introduced by reverse transcriptase when bypassing the crosslink sites have been frequently detected in CLIP-seq data (Ule et al., 2005). Therefore we also used CIMS analysis method (Zhang and Darnell, 2011) when defining the peaks. We identified 1060 peaks located on 885 protein-coding genes (513 of which are functionally annotated) (Supplementary file 1). As expected, the two different peak calling methods (with or without CIMS) showed partial overlap, with 212 genes in common. We manually inspected all genomic loci of the functionally annotated genes on the two lists and identified 533 potential targets (Supplementary file 1).

Nuclear CELF2 CLIP-seq in N2A cells

Request a detailed protocol

The Neuro2A cell line was obtained from ATCC (http://www.atcc.org/products/all/CCL-131.aspx#generalinformation) and cultured in DMEM (high glucose) containing 10% FBS with 5% CO2. To generate an inducible Neuro2A stable cell line expressing biotin-tagged Celf2 (cDNA) that can be controlled to express at endogenous levels, we modified the original in vivo biotin-tagging system using a Tet-On retroviral inducible system from Clontech. Briefly, Celf2 was fused in-frame to the C terminus of the peptide MAGGLNDIFEAQKIEWHEDTGGGGSGGGGSGENLYFQSDYKDDDDK in the BLRP expression construct. Amino acids 1–20 represent a biotin ligase recognition peptide (BLRP), in which the lysine residue at position 13 is a substrate for the bacterial biotin ligase (BirA) upon co-expression in mammalian cells (Liu et al., 2014). The glycine-rich stretch following the BLRP sequence provides a spacer region, and the ENLYFQS sequence (in bold and underlined) provides a specific cleavage site for TEV protease (Life Technologies, Carlsbad, CA). Following the TEV site, there is a FLAG tag. The BLRP-Celf2 cassette was ligated into a retrovirus-based Tet-On vector then co-transfected with pCL-Ampho packaging plasmid into 293T cell line to prepare retrovirus. Retrovirus was then transduced into a parental Neuro2A stable line that was engineered to stably express BirA and a Tet Repressor using a retroviral vector. G418 (150 μg/ml), hygromycin (200 μg/ml), and puromycin (0.7 μg/ml) were used for stable selection. BLRP-Celf2 cells were induced to express low level BLRP-Celf2 by doxycycline, then rinsed once with PBS, placed in HL-2000 Hybrilinker and irradiated at 150 mJ/cm2 on ice for 1–1.5 min. Cells were washed twice with cold PBS and collected in PBS by scraping from culture flasks. Cells were gently resuspended in 500 μl 1x Hypotonic Buffer (500 μl per 10 cm dish or 107 cells, scaled up as necessary) by pipetting up and down several times, followed by incubation on ice for 15 min. 25 μl detergent (10% NP40) was added per 500 μl 1x Hypotonic Buffer followed by vortexing for 10 s at highest speed. The homogenate ws centrifuged for 10 min at 3,000 rpm at 4°C to get the nuclear fraction in the pellet. The pellet was then washed twice in 1x Hypotonic Buffer and resuspended in 1 ml CLIP lysis buffer (50 mM Tris–HCl, pH 7.4; 100 mM NaCl; 1 mM MgCl2; 0.1 mM CaCl2; 1% NP-40; 0.5% sodium deoxycholate; 0.1% SDS; Protease inhibitor and anti-RNase) per 100 μl pellet followed by sonication on ice. 5 ul Turbo DNase was added per 1 ml of lysates followed by incubation at 37°Cfor 3–5 min. Lysates were centrifuged at 16,000 g for 10 min at 4°C and supernatants collected and incubated with streptavidin magnetic beads (Sigma) overnight on a rotator.

Beads were then treated as for the CLIP-seq in C. elegans (see above) with some modification. Complexes were eluted from the beads and run on a native 10% Bis-Tris gel followed by transferring to a nitrocellulose membrane. The band corresponding to the CELF2/RNA complexes (65–100 kDa) was cut out of the membrane. After RNA extraction, RNA was resuspended and ligated to 5′ RNA Linker with T4 RNA ligase at 16°C overnight. The ligated RNA was reverse transcribed with P3 primer (5’-CAAGCAGAAGACGGCATACGAG-3’) followed by two rounds of PCR. PCR primers 5’-CAAGCAGAAGACGGCATACGAG and 5’-GCTGATGCTACGACCACAGG-3’ were used for the first round of PCR for 12 cycles. Primer 5’-CAAGCAGAAGACGGCATACGAG-3’ and barcoded PCR primers 5’- AATGATACGGCGACCACCGAGATNNNNGCTGATGCTACGACCACAGG-3’ were used for the second round of PCR for 4 cycles. PCR product was analyzed on PAGE gel, bands corresponding to 75–150 nt were isolated and the DNA was extracted for deep sequencing. We obtained 19,563,928 reads, among which 13,505,933 were mapped to mouse genome. After filtering PCR duplicates and non-unique tags, we obtained 4,587,451 unique tags. We used an algorithm in peak calling to include peaks with and without CIMS. The peaks with top 15% significance score were distributed over 2919 protein coding genes (Supplementary file 4).

CLIP-seq bioinformatics analysis

The CLIP-seq data are available at the Gene Expression Omnibus under the accession number GSE78111.

Read preprocessing

Request a detailed protocol

The quality of sequencing reads from fastq files was evaluated by FastQC (http://www.bioinformatics.babraham.ac.uk/projects/fastqc). Sequencing adapters and over-represented short sequences were trimmed using cutadapt (Martin, 2011).

Read mapping

Request a detailed protocol

The trimmed reads from unc-75 CLIP-seq or Celf2 CLIP-seq were mapped to the C. elegans genome (WS220/ce10) or M. musculus genome (GRCm38/mm10), respectively, by GSNAP(Wu and Nacu, 2010) (version 2015-09-29) with parameters of '-t 4 -k 10 -N 1'. The coordinates of mapped reads were evaluated and filtered by custom scripts. Specifically, reads with multiple coordinates and coordinates with duplicated reads were removed by using samtools (Li et al., 2009) and bedtools (Quinlan and Hall, 2010).

Peak calling

Request a detailed protocol

Peak calling for CLIP-seq data was performed with and without considering CIMS (crosslinking-induced mutation site) as previously described (Moore et al., 2014; Zhang and Darnell, 2011), with some modifications. Using samtools and bedtools, mutation information in the read mapping was extracted, then CIMS analysis was applied to the read coordinates to detect significant peaks at FDR < 0.01 and m > 5.

Motif finding

Request a detailed protocol

We used MEME-ChIP (Machanick and Bailey, 2011) for de novo identification of motifs enriched in CLIP-seq peaks with 20 bp extensions with both directions, using flanking sequences (100 bp length with 100 bp gap, extracted with bedtools) as background controls.

RNA-seq

Request a detailed protocol

3’-RNA-seq was performed as previously described (Fox-Walsh et al., 2011). Briefly, total RNA was extracted from synchronized worms using Trizol (Invitrogen). cDNA synthesis was performed using SuperScript III (Invitrogen) and 3 µg of total RNA, together with 1 µl of 50 µM Biotin labeled oligodT and Adaptor-Random primers. cDNA was then purified using PCR purification kit (Macherey-Nagel) followed by terminal transferase treatment to add ddNTP to protect 3’-end. cDNA was then captured using streptavidin coated magnetic beads and primer extension was done on beads with Adaptor-Random primers. DNA was then eluted from beads by heating to 95°C before PCR amplification using barcoded primers. PCR products were then size selected and used for deep sequencing.

Generation of Celf2 floxed allele

Request a detailed protocol

Mouse husbandry and surgeries were performed under the supervision of the University of California San Diego Institutional Animal Care and Use Committee (IACUC). We used homologous recombination to create a 'floxed' Celf2 allele consisting of loxP sites flanking Celf2 exon 3 (Figure 6—figure supplement 1). A 1.1 kb genomic DNA fragment containing Celf2 exon 3 was cloned into the targeting vector, flanked by two loxP sites. 2.2 kb genomic DNA upstream and a 4.8 kb genomic DNA fragment downstream to the 1.1 kb fragment were cloned into the targeting vector to generate 5’ and 3’ homology arms. The targeting vector was linearized by Not I digestion and transfected to CB6F1 ES cells. Homologous recombination was analyzed by Southern blotting using probes generated by PCR using the following primers: (5’ probe: For-GGGACAGCAAGAAAGACAGT; Rev- CATAGATGCAGCATTTAGTAGG. 3’ probe: For-ACTCATTTCATTAAGGTTGTA; Rev-TAGTTTATCAGGACCATTTG). Cells heterozygous for the targeted mutation were microinjected into blastocysts to obtain germ-line transmission following standard procedures. Mice were genotyped using PCR (primers: For-GAGGTGTCTGCCGAACT; Rev-CACTCAGTCCCTGTTTGTAA; Wt 470 bp, mutant 370 bp).

ZP3-Cre (Lewandoski et al., 1997) was used to generate Celf2 null allele Celf2-. A Parvalbumin-Cre transgene (Hippenmeyer et al., 2005) was used to delete Celf2 and Rosa26-tdTomato (Madisen et al., 2010) was used to label the Cre+ cells. Parvalbumin-Cre; Rosa26-tdTomato mice were crossed to Celf +/- mice to generate PV-Cre; Rosa26-tdTomato; Celf2null/+ progeny, which were then crossed to Celf2fx/fx mice to generate PV-cre; Rosa26-tdTomato; Celf2fx/- animals for in vivo axon regeneration experiments.

DRG explant and adult DRG culture

Request a detailed protocol

E13.5 mouse embryos were dissected from the uterus and put into cold F12 medium. The embryo was opened to expose the entire spinal cord which was then lifted to allow the dorsal root ganglia to be removed and transferred to culture medium (NB + 2% B27 + 10% FBS + L-glutamine) then to cover slips pre-coated with poly-ornithine and 5 μg/ml laminin. The DRGs were allowed to adhere for 4 hr before flooding the wells with culture medium. 24 hr later, DRGs were fixed with 4% PFA and stained with anti-Tuj1 (Covance, MMS-435P).

Adult (8 weeks) DRGs were dissected in cold F12 medium and then digested with 0.5 mg/ml collagenase (Roche, 10103578001) and 1 mg/ml dispase (Roche, 04942078001) for 40 min at 37°C followed by 0.125% trypsin digestion for 30 min at 37°C. Tissues were triturated in culture medium (NBA with 2% of B27 and 10% of FBS) with 1 ml tips and passed through a 0.45 μm cell strainer. Cells passing through the strainer were spun down and re-suspended in culture medium and plated to 12-well plates pre-coated with poly-ornithine and 5 μg/ml laminin. For in vitro axon regrowth analysis, 24 hr after plating, cells were re-suspended and re-plated to pre-coated cover slips. 24 hr later, re-plated cells were fixed and stained with anti-Tuj1.

Sciatic nerve crush and axon regeneration analysis

Request a detailed protocol

2 month old mice were anesthetized with isoflurane and the sciatic nerve exposed by a small incision on the skin. The nerve was crushed with a pair of fine (#55) forceps for 20 s and the crush site marked using activated carbon powder (Bauder and Ferguson, 2012). 3 days later the mice were euthanized by CO2 and sciatic nerves obtained for analysis. Sciatic nerves were fixed in 4% paraformaldehyde for 3 hr, then washed with PBS, immersed in 30% sucrose in PBS, cryopreserved in OCT compound (TissueTek) and cryosectioned at 10 μm thickness. Samples were immunostained with anti-SCG10 (1:3000) (Novus Biologicals STMN2 NBP1-49461). After staining, multiple images along the nerve were taken using a 10X objective (Zeiss LSM710) and montaged using Photoshop (Adobe). Representative images are shown in Figure 6D. We used Metamorph software to measure SCG10 staining fluorescence intensity in tdTomato positive axons (Cre-expressing neurons). At each distance point, at least 10–20 regions with tdTomato signal were randomly selected in the red channel and regions of interest (ROI) defined. These regions were then transferred to the green channel and the average intensity of green fluorescence measured. Average intensity from all the regions at each distance point was then normalized to the average intensity immediately proximal to the crush site.

RNA extraction and RT-qPCR

Request a detailed protocol

Total RNA from worms or mouse tissues (E15.5 embryonic brains or dorsal root ganglia at different stages) were extracted using Trizol (Invitrogen) or RNeasy kit (Qiagen) following the manufacturers’ protocols. First strand cDNA was reverse-transcribed using SuperScript III (Invitrogen). qPCR was run on Bio-Rad CFX96 Touch Real-Time PCR Detection System with iQ SYBR Supermix (Bio-Rad). Data were analyzed using CFX manager (Bio-Rad). PCR primers are listed in (Supplementary file 6).

Statistical analysis

Request a detailed protocol

A two-tailed Student’s test was used for comparisons of two groups. One-way ANOVA with Bonferroni post test was used to compare multiple groups in Prism (GraphPad, La Jolla, CA).

References

    1. Benowitz LI
    2. Shashoua VE
    3. Yoon MG
    (1981)
    Specific changes in rapidly transported proteins during regeneration of the goldfish optic nerve
    Journal of Neuroscience 1:300–307.

Article and author information

Author details

  1. Lizhen Chen

    1. Section of Neurobiology, University of California, San Diego, Division of Biological Sciences, San Diego, United States
    2. Howard Hughes Medical Institute, University of California, San Diego, United States
    Present address
    Department of Cellular and Structural Biology, University of Texas Health Science Center at San Antonio, Barshop Institute for Longevity and Aging Studies, San Antonio, United States
    Contribution
    LC, Conception and design, Acquisition of data, Analysis and interpretation of data, Drafting or revising the article
    Competing interests
    The authors declare that no competing interests exist.
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0001-5313-7340
  2. Zhijie Liu

    Department of Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    ZL, Conception and design, Acquisition of data, Analysis and interpretation of data
    Competing interests
    The authors declare that no competing interests exist.
  3. Bing Zhou

    Department of Cellular and Molecular Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    BZ, Conception and design, Analysis and interpretation of data
    Competing interests
    The authors declare that no competing interests exist.
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0003-2846-1813
  4. Chaoliang Wei

    Department of Cellular and Molecular Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    CW, Conception and design, Contributed unpublished essential data or reagents
    Competing interests
    The authors declare that no competing interests exist.
  5. Yu Zhou

    Department of Cellular and Molecular Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    YZ, Conception and design, Analysis and interpretation of data
    Competing interests
    The authors declare that no competing interests exist.
  6. Michael G Rosenfeld

    1. Howard Hughes Medical Institute, University of California, San Diego, United States
    2. Department of Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    MGR, Contributed unpublished essential data or reagents
    Competing interests
    The authors declare that no competing interests exist.
  7. Xiang-Dong Fu

    Department of Cellular and Molecular Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    X-DF, Analysis and interpretation of data, Contributed unpublished essential data or reagents
    Competing interests
    The authors declare that no competing interests exist.
  8. Andrew D Chisholm

    Section of Neurobiology, University of California, San Diego, Division of Biological Sciences, San Diego, United States
    Contribution
    ADC, Conception and design, Analysis and interpretation of data, Drafting or revising the article
    For correspondence
    chisholm@ucsd.edu
    Competing interests
    The authors declare that no competing interests exist.
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0001-5091-0537
  9. Yishi Jin

    1. Section of Neurobiology, University of California, San Diego, Division of Biological Sciences, San Diego, United States
    2. Howard Hughes Medical Institute, University of California, San Diego, United States
    3. Department of Cellular and Molecular Medicine, University of California, San Diego, School of Medicine, San Diego, United States
    Contribution
    YJ, Conception and design, Analysis and interpretation of data, Drafting or revising the article
    For correspondence
    yijin@ucsd.edu
    Competing interests
    The authors declare that no competing interests exist.
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-9371-9860

Funding

National Institutes of Health (HG004659)

  • Xiang-Dong Fu

National Institutes of Health (GM049369)

  • Xiang-Dong Fu

National Institute of Neurological Disorders and Stroke (R01NS093588)

  • Andrew D Chisholm
  • Yishi Jin

National Institute of Neurological Disorders and Stroke (R01NS057317)

  • Andrew D Chisholm
  • Yishi Jin

National Institute of Neurological Disorders and Stroke (R56NS057317)

  • Andrew D Chisholm
  • Yishi Jin

Howard Hughes Medical Institute (Yishi Jin)

  • Yishi Jin

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.

Acknowledgements

We thank Michael Nonet and James Rand for reagents, and Edmund Hollis II for advice on sciatic nerve injury. We thank members of the Jin and Chisholm labs for discussion and advice. LC was partly supported by the Neuroplasticity of Aging Training Grant (NIH T32 AG000216). Some strains were obtained from the Caenorhabditis Genetics Center, which is supported by the NIH Office of Research Infrastructure Programs (P40 OD010440). LC was an Associate and YJ is an Investigator of the Howard Hughes Medical Institute. Supported by grants from NIH (HG004659 and GM049369 to XDF; R01NS093588, R01NS057317, and R56NS057317 to ADC and YJ).

Ethics

Animal experimentation: This study was performed in strict accordance with the recommendations in the Guide for the Care and Use of Laboratory Animals of the National Institutes of Health. All of the animals were handled according to approved institutional animal care and use committee (IACUC) protocols (S13072) of the University of California. All surgery was performed under anesthesia, and every effort was made to minimize suffering.

Copyright

© 2016, Chen et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.

Metrics

  • 3,442
    views
  • 724
    downloads
  • 29
    citations

Views, downloads and citations are aggregated across all versions of this paper published by eLife.

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Downloads (link to download the article as PDF)

Open citations (links to open the citations from this article in various online reference manager services)

Cite this article (links to download the citations from this article in formats compatible with various reference manager tools)

  1. Lizhen Chen
  2. Zhijie Liu
  3. Bing Zhou
  4. Chaoliang Wei
  5. Yu Zhou
  6. Michael G Rosenfeld
  7. Xiang-Dong Fu
  8. Andrew D Chisholm
  9. Yishi Jin
(2016)
CELF RNA binding proteins promote axon regeneration in C. elegans and mammals through alternative splicing of Syntaxins
eLife 5:e16072.
https://doi.org/10.7554/eLife.16072

Share this article

https://doi.org/10.7554/eLife.16072

Further reading

    1. Cell Biology
    2. Neuroscience
    Jun Sun, Francisca Rojo-Cortes ... Alicia Hidalgo
    Research Article

    Experience shapes the brain as neural circuits can be modified by neural stimulation or the lack of it. The molecular mechanisms underlying structural circuit plasticity and how plasticity modifies behaviour are poorly understood. Subjective experience requires dopamine, a neuromodulator that assigns a value to stimuli, and it also controls behaviour, including locomotion, learning, and memory. In Drosophila, Toll receptors are ideally placed to translate experience into structural brain change. Toll-6 is expressed in dopaminergic neurons (DANs), raising the intriguing possibility that Toll-6 could regulate structural plasticity in dopaminergic circuits. Drosophila neurotrophin-2 (DNT-2) is the ligand for Toll-6 and Kek-6, but whether it is required for circuit structural plasticity was unknown. Here, we show that DNT-2-expressing neurons connect with DANs, and they modulate each other. Loss of function for DNT-2 or its receptors Toll-6 and kinase-less Trk-like kek-6 caused DAN and synapse loss, impaired dendrite growth and connectivity, decreased synaptic sites, and caused locomotion deficits. In contrast, over-expressed DNT-2 increased DAN cell number, dendrite complexity, and promoted synaptogenesis. Neuronal activity modified DNT-2, increased synaptogenesis in DNT-2-positive neurons and DANs, and over-expression of DNT-2 did too. Altering the levels of DNT-2 or Toll-6 also modified dopamine-dependent behaviours, including locomotion and long-term memory. To conclude, a feedback loop involving dopamine and DNT-2 highlighted the circuits engaged, and DNT-2 with Toll-6 and Kek-6 induced structural plasticity in this circuit modifying brain function and behaviour.

    1. Neuroscience
    Walter Senn, Dominik Dold ... Mihai A Petrovici
    Research Article

    One of the most fundamental laws of physics is the principle of least action. Motivated by its predictive power, we introduce a neuronal least-action principle for cortical processing of sensory streams to produce appropriate behavioral outputs in real time. The principle postulates that the voltage dynamics of cortical pyramidal neurons prospectively minimizes the local somato-dendritic mismatch error within individual neurons. For output neurons, the principle implies minimizing an instantaneous behavioral error. For deep network neurons, it implies the prospective firing to overcome integration delays and correct for possible output errors right in time. The neuron-specific errors are extracted in the apical dendrites of pyramidal neurons through a cortical microcircuit that tries to explain away the feedback from the periphery, and correct the trajectory on the fly. Any motor output is in a moving equilibrium with the sensory input and the motor feedback during the ongoing sensory-motor transform. Online synaptic plasticity reduces the somatodendritic mismatch error within each cortical neuron and performs gradient descent on the output cost at any moment in time. The neuronal least-action principle offers an axiomatic framework to derive local neuronal and synaptic laws for global real-time computation and learning in the brain.