1. Microbiology and Infectious Disease
Download icon

Post-translational thioamidation of methyl-coenzyme M reductase, a key enzyme in methanogenic and methanotrophic Archaea

  1. Dipti D Nayak
  2. Nilkamal Mahanta
  3. Douglas A Mitchell  Is a corresponding author
  4. William W Metcalf  Is a corresponding author
  1. University of Illinois, United States
Research Article
  • Cited 10
  • Views 1,123
  • Annotations
Cite as: eLife 2017;6:e29218 doi: 10.7554/eLife.29218


Methyl-coenzyme M reductase (MCR), found in strictly anaerobic methanogenic and methanotrophic archaea, catalyzes the reversible production and consumption of the potent greenhouse gas methane. The α subunit of MCR (McrA) contains several unusual post-translational modifications, including a rare thioamidation of glycine. Based on the presumed function of homologous genes involved in the biosynthesis of thioviridamide, a thioamide-containing natural product, we hypothesized that the archaeal tfuA and ycaO genes would be responsible for post-translational installation of thioglycine into McrA. Mass spectrometric characterization of McrA from the methanogenic archaeon Methanosarcina acetivorans lacking tfuA and/or ycaO revealed the presence of glycine, rather than thioglycine, supporting this hypothesis. Phenotypic characterization of the ∆ycaO-tfuA mutant revealed a severe growth rate defect on substrates with low free energy yields and at elevated temperatures (39°C - 45°C). Our analyses support a role for thioglycine in stabilizing the protein secondary structure near the active site.



Methyl-coenzyme M reductase (MCR) is a unique enzyme found exclusively in anaerobic archaea, where it catalyzes the reversible conversion of methyl-coenzyme M (CoM, 2-methylmercaptoethanesulfonate) and coenzyme B (CoB, 7-thioheptanoylthreoninephosphate) to methane and a CoB-CoM heterodisulfide (Ermler et al., 1997; Scheller et al., 2010):


This reaction, which has been proposed to proceed via an unprecedented methyl radical intermediate (Wongnate et al., 2016), plays a critical role in the global carbon cycle (Thauer et al., 2008). In the forward direction, MCR catalyzes the formation of methane in methane-producing archaea (methanogens). In the reverse direction, MCR catalyzes the consumption of methane in methanotrophic archaea (known as ANMEs, for anaerobic oxidation of methane). Together, these processes produce and consume gigatons of methane each year, helping to establish the steady-state atmospheric levels of an important greenhouse gas. MCR displays an α2β2γ2 protein domain architecture and contains two molecules of F430, a nickel porphinoid cofactor (Ermler et al., 1997; Zheng et al., 2016; Moore et al., 2017). The reduced Ni(I) form of F430 is essential for catalysis (Goubeaud et al., 1997), but is highly sensitive to oxidative inactivation, a feature that renders biochemical characterization of MCR especially challenging. As a result, many attributes of this important enzyme remain uncharacterized.

An unusual feature of MCR is the presence of several modified amino acids within the active site of the α-subunit. Among these are a group of methylated amino acids, including 3-methylhistidine (or N1-methylhistidine), S-methylcysteine, 5(S)-methylarginine, and 2(S)-methylglutamine, which are presumed to be installed post-translationally by S-adenosylmethionine-dependent methyltransferases (Selmer et al., 2000; Kahnt et al., 2007). 3-methylhistidine is found in all MCRs examined to date, whereas the presence of the other methylated amino acids is variable among methane-metabolizing archaea (Kahnt et al., 2007). A didehydroaspartate modification is also observed in some, but not all, methanogens (Wagner et al., 2016). Lastly, a highly unusual thioglycine modification, in which the peptide amide bond is converted to a thioamide, is present in all methanogens that have been analyzed to date (Figure 1—figure supplement 1) (Ermler et al., 1997; Kahnt et al., 2007).

The function(s) of the modified amino acids in MCR has/have not yet been experimentally addressed; however, several theories have been postulated. The 3-methylhistidine may serve to position the imidazole ring that coordinates CoB. This methylation also alters the pKa of histidine in a manner that would promote tighter CoB-binding (Grabarse et al., 2000). The variable occurrence of the other methylated amino acids suggests that they are unlikely to be directly involved in catalysis. Rather, it has been hypothesized that they tune enzyme activity by altering the hydrophobicity and flexibility of the active site pocket (Kahnt et al., 2007; Grabarse et al., 2000). A similar argument has been made for the didehydroaspartate residue (Wagner et al., 2016). In contrast, three distinct mechanistic hypotheses have implicated the thioglycine residue in catalysis. One proposal is that the thioglycine facilitates deprotonation of CoB by reducing the pKa of the sulfhydryl group (Grabarse et al., 2001). A second proposal suggests that thioglycine could serve as an intermediate electron carrier for oxidation of a proposed heterodisulfide anion radical intermediate (Horng et al., 2001). Lastly, cis-trans isomerization of the thioamide during catalysis could potentially play an important role in coupling the two active sites via a previously proposed two-stroke mechanism for the enzyme (Goenrich et al., 2005).

Thioamides are rare in biology. While cycasthioamide is plant-derived (Pan et al., 1997), most other naturally occurring thioamides are of bacterial origin. Among these are the ribosomally synthesized and post-translationally modified (RiPP) peptide natural products thioviridamide (Hayakawa et al., 2006) and methanobactin (Kim et al., 2004; Kenney and Rosenzweig, 2012; Kenney and Rosenzweig, 2013), as well as closthioamide, which appears to be an unusual non-ribosomal peptide (Lincke et al., 2010; Chiriac et al., 2015). The nucleotide derivatives thiouridine and thioguanine (Coyne et al., 2014), and two additional natural product antibiotics, thiopeptin and Sch 18640 (Puar et al., 1981; Hensens and Albers-Schönberg, 1983), also contain thioamide moieties. Although the mechanism of thioamide installation in peptides has yet to be established, the identification of the thioviridamide biosynthetic gene cluster provides clues to their origin (Izawa et al., 2013). Two of the proteins encoded by this gene cluster have plausible roles in thioamide synthesis. The first, TvaH, is a member of the YcaO superfamily, while the second, TvaI, is annotated as a ‘TfuA-like’ protein (Izawa et al., 2013). Biochemical analyses of YcaO-family proteins indicate that they catalyze the ATP-dependent cyclodehydration of Cys, Ser, and Thr residues to the corresponding thiazoline, oxazoline, and methyloxazoline (Figure 1). Many ‘azoline’ heterocycles undergo dehydrogenation to the corresponding azole, which are prominent moieties in various RiPP natural products classes, such as linear azol(in)e-containing peptides, thiopeptides, and cyanobactins (Dunbar et al., 2012; Dunbar et al., 2014; Arnison et al., 2013; Burkhart et al., 2017). The YcaO-dependent synthesis of peptidic azol(in)e heterocycles often requires a partner protein, which typically is the neighboring gene in the biosynthetic gene cluster (Burkhart et al., 2015; Dunbar et al., 2015; Wright et al., 2006). Based on enzymatic similarity, the TfuA protein encoded adjacent to the YcaO in the thioviridamide pathway may also enhance the thioamidation reaction, perhaps by recruiting a sulfurtransferase protein. Although not RiPPs, thiouridine and thioguanine biosynthesis requires the use of sulfurtransferases (Coyne et al., 2013; Palenchar et al., 2000).

Figure 1 with 1 supplement see all
Comparison of reactions catalyzed by YcaO proteins.

Top, Biochemically characterized YcaO proteins involved in the synthesis of azol(in)e-containing ribosomal natural products catalyze the ATP-dependent cyclodehydration of cysteine, serine, and threonine residues. Shown is the conversion of peptidic cysteine to thiazoline. This reaction proceeds via an O-phosphorylated hemiorthoamide intermediate. Bottom, An analogous reaction is believed to occur in the biosynthesis of the thioamide bond in thioviridamide. Rather than an adjacent cysteine acting as the nucleophile, an exogenous source of sulfide (S2-) is required for this reaction.


The biosynthesis of the thioglycine in MCR was proposed to occur by a mechanism similar to that used to produce thioamide-containing natural products (Kahnt et al., 2007), a prediction made six years prior to the discovery of the thioviridamide biosynthetic gene cluster (Izawa et al., 2013). Given their putative role in thioamidation reactions, it is notable that YcaO homologs were found to be universally present in an early analysis of methanogen genomes, resulting in their designation as ‘methanogenesis marker protein 1’ (Basu et al., 2011). Genes encoding TfuA homologs are also ubiquitous in methanogens, usually encoded in the same locus as ycaO, similar to their arrangement in the thioviridamide biosynthetic gene cluster. Therefore, both biochemical and bioinformatic evidence are consistent with these genes being involved in thioglycine formation. In this report, we use the genetically tractable methanogen Methanosarcina acetivorans to show that installation of the thioamide bond at Gly465 in the α-subunit of MCR requires the ycaO-tfuA locus (Figure 1—figure supplement 1). As MCR is essential for growth and survival (Rother et al., 2005), the viability of ycaO-tfuA mutants precludes the hypothesis that the thioamide residue is essential for MCR activity. Instead, our phenotypic analyses support a role for thioglycine in maintaining a proper structural conformation of residues near the active site, such that absence of this modification in MCR might be particularly detrimental on growth substrates that have low free energy yields as well as under additionally destabilizing conditions such as elevated temperatures.


Phylogenetic analyses of TfuA and YcaO in methanogenic and methanotrophic archaea

To examine the possibility that YcaO and TfuA are involved in McrA thioamidation, we reassessed the distribution, diversity, and phylogeny of genes encoding these proteins in sequenced microbial genomes, which today comprise a much larger dataset than when ‘methanogenesis marker protein 1’ was first proposed (Basu et al., 2011). Significantly, all complete methanogen and ANME genome sequences encode a YcaO homolog, with a few strains encoding two copies (Figure 2). The YcaO sequences form a distinct, well-supported clade that also includes homologs from ammonia-oxidizing archaea (Figure 2—figure supplement 1). Excluding the second YcaO in strains that encode two copies, the YcaO tree is congruent with the phylogeny of methanogens reconstructed using housekeeping or mcr genes (Figure 2). Thus, it is likely that YcaO was acquired early in the evolution of methanogens and maintained largely through vertical inheritance, as expected for a trait that coevolved with MCR (Borrel et al., 2013; Vanwonterghem et al., 2016).

Figure 2 with 2 supplements see all
A maximum-likelihood phylogenetic tree of YcaO homologs in archaea.

Taxa in green, blue, and orange depict methanogens and anaerobic methane-oxidizing archaea (ANMEs) with sequenced genomes. Taxa shown in green contain a single copy of ycaO and tfuA, those in blue contain two copies of ycaO and one copy of tfuA, while those in orange contain one copy of ycaO, but do not encode tfuA. Taxa shown in pink are other archaea that also encode ycaO and tfuA homologs. The gene neighborhoods of selected taxa are also depicted, showing the common co-localization with genes annotated as having a role in sulfur metabolism or methanogenesis. The node labels indicate support values calculated using the Shiomdaira-Hasegawa test using 1000 resamples. Support values less than 0.5 have not been shown. The outgroup displayed derives from a variety of bacterial YcaO proteins.


TfuA homologs are encoded in the overwhelming majority of MCR-encoding taxa, although a few species lack this gene. The latter include Methanopyrus kandleri and Methanocaldococcus janaschii, two species previously shown to contain the thioglycine modification (Kahnt et al., 2007) (Figure 2). Thus, TfuA cannot be obligatorily required for thioglycine installation. The archaeal TfuA proteins also fall within a single clade that is largely congruent with the evolutionary history of archaea (Figure 2—figure supplements 12); however, unlike YcaO, the methanogen-containing clade includes numerous bacterial homologs (Figure 2—figure supplement 2).

The genomic context of tfuA and ycaO in methanogens supports a shared or related function, perhaps involving sulfur incorporation and/or methanogenesis (Figure 2). When both are present, the two genes comprise a single locus in which the stop codon of the upstream ycaO gene overlaps with the start codon of the downstream tfuA gene, suggesting that they are co-transcribed. In several instances, additional genes involved in sulfur metabolism such as thiF, sufS, as well as moaD, moaE and moeB (involved in molybdopterin biosynthesis) (Zhang et al., 2010; Park et al., 2003), are found in the genomic vicinity. Occasionally, genes encoding enzymes involved in methanogenesis, including the Methanomassiliicoccus MCR operon, are locally encoded (Figure 2).

TfuA and YcaO are not essential in Methanosarcina acetivorans

To test their role in thioglycine installation, we generated a mutant lacking the ycaO-tfuA locus in the genetically tractable methanogen Methanosarcina acetivorans. Based on the hypothesis that thioglycine may be imperative for MCR activity, and the knowledge that the MCR-encoding operon (mcrBCDAG) is essential (Guss et al., 2008), we first examined the viability of ΔycaO-tfuA mutants using a recently developed Cas9-based assay for gene essentiality (Nayak and Metcalf, 2017). This assay compares the number of transformants obtained using a Cas9 gene-editing plasmid with and without a repair template that creates a gene deletion. Essential genes give similar, low numbers of transformants with or without the repair template; whereas non-essential genes give ca. 103-fold higher numbers with the repair template. Our data demonstrate that deletion of the ycaO-tfuA locus has no impact on viability (Figure 3). Several independent mutants were clonally purified and verified by PCR prior to phenotypic characterization (Figure 3—figure supplement 1).

Figure 3 with 2 supplements see all
Panel A, Experimental strategy for deletion of the ycaO-tfuA locus in M. acetivorans using a Cas9-mediated genome editing technique.

Co-expression of the Cas9 protein along with a single guide RNA (sgRNA) with a 20 bp target sequence flanked by a 3’ NGG protospacer adjacent motif on the chromosome (PAM; in red) generates double-stranded breaks at the ycaO-tfuA locus. Repair of this break via homologous recombination with an appropriate repair template (HR Template) generates an in-frame deletion on the host chromosome. Panel B, A Cas9-based assay for gene essentiality. Mean transformation efficiencies of plasmids with (dark gray) or without (light gray) an appropriate repair template are shown. The known essential gene mcrA is included as a positive control. The error bars represent one standard deviation of three independent transformations.


The ∆ycaO-tfuA mutant lacks the McrA Gly465 thioamide

To test whether YcaO and TfuA are involved in the post-translational modification of Gly465 in McrA, we isolated the McrA protein from cell extracts of the isogenic parent (hereafter referred to as wild-type or WT), the ∆ycaO-tfuA mutant, as well as from ∆tfuA and ∆ycaO individual mutants (Figure 3—figure supplement 2). After performing SDS-PAGE, the appropriate Coomassie-stained bands were excised and then subjected to in-gel trypsin digestion. The resulting peptides were then analyzed by matrix-assisted laser desorption-ionization time-of-flight mass spectrometry (MALDI-TOF-MS). The mass spectrum from the WT strain showed a peak at m/z 3432 Da (Figure 4) corresponding to the peptide (461LGFFGFDLQDQCGATNVLSYQGDEGLPDELR491) with Gly465 being thioamidated (Kahnt et al., 2007; Grabarse et al., 2000). The identity of this peptide was confirmed by high-resolution electrospray ionization tandem MS analysis (HR-ESI-MS/MS, [M + 3H]3+ expt. m/z 1144.8608 Da; calc. m/z 1144.8546 Da; 5.4 ppm error; Figure 4—figure supplement 1A). This peptide also contains the recently reported didehydroaspartate modification at Asp470 (Wagner et al., 2016) and S-methylation at Cys472 (Selmer et al., 2000). Consistent with the involvement of TfuA-associated YcaO proteins in thioamide formation, we noted the absence of the m/z 3432 Da species in the mass spectrum of similarly treated ∆ycaO-tfuA, ∆tfuA, and ∆ycaO samples. Instead, a predominant m/z 3416 Da species appeared, which was 16 Da lighter, consistent with replacement of sulfur by oxygen (Figure 4). HR-ESI-MS/MS analysis of the corresponding peptide from the ∆ycaO-tfuA mutant confirmed the identity of this peptide as being McrA Leu461-Arg491 ([M + 3H]3+ expt. m/z 1139.5316 Da; calc. m/z 1139.5290 Da; 2.3 ppm error; Figure 4—figure supplement 1B). During HR-ESI-MS/MS analysis of the WT, thioamide-containing peptide, we did not observe fragmentation between Gly465 and Phe466. In contrast, fragmentation was seen at this location in the ∆ycaO-tfuA strain (b5 ion, Figure 4—figure supplement 1B). The lack of fragmentation in the WT peptide was anticipated based on the greater double bond character of C-N bonds in thioamides (Wiberg and Rablen, 1995).

Figure 4 with 3 supplements see all
MALDI-TOF MS analysis of McrA.

Panel A, Spectrum obtained from trypsinolysis of WT MCR, which contains the thioglycine-modified L461-R491 peptide (m/z 3432 Da). A small amount of the unmodified L461-R491 peptide (m/z 3416 Da) is also observed, which probably arises via non-enzymatic hydrolysis of the thioamide bond as previously reported (Kahnt et al., 2007). Panels B, C, D, Spectrum obtained from trypsinolysis of McrA from the ∆ycaO-tfuA, ∆tfuA, ∆ycaO strains, respectively, containing only the unmodified L461-R491 peptide (m/z 3416 Da). Panels E, F, G. Spectrum obtained from trypsinolysis of MCR from the ∆ycaO-tfuA mutant complemented with PmcrB(tetO4)-ycaO-tfuA, ∆tfuA mutant complemented with PmcrB(tetO4)-tfuA, ∆ycaO mutant complemented with PmcrB(tetO4)-ycaO, respectively. Tetracycline was added to a final concentration of 100 µg/mL to the growth medium to induce expression from the PmcrB(tetO4) promoter. All three spectra contain the thioglycine-modified Leu461-Arg491 peptide (m/z 3432 Da). The m/z 3375 Da species present in all samples corresponds to McrA residues D392-R421.


To confirm that mutations in ycaO and/or tfuA were responsible for loss of the thioglycine modification, we transformed the ∆ycaO-tfuA mutant with a self-replicating plasmid containing the ycaO-tfuA locus fused to the tetracycline-inducible promoter PmcrB(tetO4) (Guss et al., 2008). Upon tryptic digestion of MCR from cultures supplemented with tetracycline, a peak at m/z 3432 Da reappeared (Figure 4). Similar results were obtained when complementation experiments were performed with the ycaO or tfuA genes in the corresponding single mutants (Figure 4).

The m/z 3375 Da species present in all samples corresponds to an unrelated tryptic peptide, McrA Asp392-Arg421 (Figure 4—figure supplement 2). We also observed a peak at m/z 1496 in the WT and mutant samples corresponding to a N-methylhistidine-containing tryptic peptide (His271-Arg284, Figure 4—figure supplement 3A). Thus, thioglycine formation is not a prerequisite for this modification. Additionally, a peak at m/z 1561 was observed, corresponding to McrA Phe408-Arg421, shows that Gln420 remains unmodified in M. acetivorans, as previously been observed for Methanosarcina barkeri (Figure 4—figure supplement 3B) (Kahnt et al., 2007).

Growth defects associated with loss of the McrA thioglycine modification

To understand potential phenotypic consequences of losing the thioglycine modification, we quantified the doubling time and growth yield by monitoring changes in optical density during growth of M. acetivorans on a variety of substrates (Table 1). While no significant differences were observed during growth on methanol or trimethylamine (TMA) at 36°C, the ∆ycaO-tfuA mutant had substantially longer generation times and lower cell yields on both dimethylsulfide (DMS) and acetate (Table 1). Interestingly, the growth phenotype on methanol medium was strongly temperature-dependent, with no observed differences at 29°C and 36°C, but severe defects observed for the ∆ycaO-tfuA mutant at 39°C and 42°C. Furthermore, unlike WT, the mutant was incapable of growth at 45°C (Figure 5).

Figure 5 with 2 supplements see all
Growth rate of WT (blue) and the ∆ycaO-tfuA mutant (green) in HS medium with 125 mM methanol at the indicated temperatures.

A statistically significant difference (p<0.01) using a two-tailed unpaired t-test is indicated with an *. NG indicates that no growth was detected after one month of incubation.

Table 1
Growth phenotypes of M. acetivorans WT and the ∆ycaO-tfuA mutant on different substrates at 36°C.
Substrate*StrainDoubling time (h)p-value
Maximum OD600p-value
MethanolWT6.94 ± 0.410.875.35 ± 0.310.26
 ∆ycaO-tfuA6.89 ± 0.155.06 ± 0.39
TMAWT10.92 ± 0.540.849.57 ± 0.670.31
 ∆ycaO-tfuA10.98 ± 0.438.91 ± 0.73
AcetateWT54.23 ± 4.030.00020.44 ± 0.010.0005
 ∆ycaO-tfuA124.33 ± 12.520.35 ± 0.02
DMSWT31.27 ± 1.28<0.00010.60 ± 0.01<0.0001
 ∆ycaO-tfuA58.28 ± 1.450.44 ± 0.01
  1. *TMA, trimethylamine; DMS, dimethylsulfide.

    The error represents the 95% confidence interval of the mean for three biological replicates and the p-values were calculated using two-tailed unpaired t-tests.

Thioglycine does not influence the global stability of MCR

Given that the C-N bond rotation barrier is higher for thioamides relative to amide (Wiberg and Rablen, 1995), we tested if the presence of thioglycine promotes the thermal stability of MCR. We evaluated thermal stability by assaying the melting temperature of MCR purified from WT and the ∆ycaO-tfuA mutant. A tandem affinity purification (TAP) tag consisting of a 3 × FLAG tag and a Twin-Strep tag was introduced immediately upstream of the start codon of mcrG (Figure 5—figure supplement 1A). The proteins were affinity-purified using a Strep-tactin resin under aerobic conditions (Figure 5—figure supplement 1B). Using the SYPRO Orange-based Thermofluor assay (Huynh and Partch, 2015), the melting temperature of WT MCR was 67.3 ± 0.3°C (mean ± 95% confidence interval of three technical replicates) whereas the melting temperature for the MCR variant lacking thioglycine was 69.1 ± 0.2°C. Additionally, quantification of the protein and F430 concentrations by Bradford assay and absorption at 280/430 nm demonstrated that the F430 content was not significantly affected by the presence of thioglycine (Figure 5—figure supplement 2).


The loss of the thioglycine modification in the ∆ycaO, ∆tfuA, and ΔycaO-tfuA mutants shows that both of these genes are required for the thioamidation of McrA. Although this could be an indirect requirement, we believe it is more likely that the YcaO/TfuA proteins directly catalyze modification of McrA. This conclusion is mechanistically compatible with biochemical analyses of YcaO homologs. YcaO enzymes that carry out the ATP-dependent cyclodehydration of beta-nucleophile-containing amino acids have been extensively investigated (Burkhart et al., 2017). Such cyclodehydratases coordinate the nucleophilic attack of the Cys, Ser, and Thr side chain on the preceding amide carbonyl carbon in a fashion reminiscent of intein splicing (Perler et al., 1997) (Figure 1). The enzyme then O-phosphorylates the resulting oxyanion and subsequently N-deprotonates the hemiorthoamide, yielding an azoline heterocycle. An analogous reaction can be drawn for the YcaO-dependent formation of peptidic thioamides. The only difference is that an exogenous equivalent of sulfide is required for the thioamidation reaction, rather than an adjacent beta-nucleophile-containing amino acid for azoline formation (Figure 1).

Most YcaO cyclodehydratases require a partner protein for catalytic activity. The earliest investigated YcaO partner proteins are homologs of the ThiF/MoeB family, which are related to E1 ubiquitin-activating enzymes (Dunbar et al., 2014; Schulman et al., 2009). These YcaO partner proteins, as well as the more recently characterized ‘ocin-ThiF’ variety (Dunbar et al., 2015), contain a ~ 90 residue domain referred to as the RiPP precursor peptide Recognition Element (RRE), which facilitates substrate recognition by interacting with the leader peptide. Considering these traits of azoline-forming YcaOs, it is possible that thioamide-forming YcaOs require the TfuA partner to facilitate binding to the peptidic substrate. Alternatively, TfuA may recruit and deliver sulfide equivalents by a direct or indirect mechanism. In this regard, it is noteworthy that the ycaO-tfuA locus can be found adjacent to genes involved in sulfur and molybdoterin metabolism (Figure 2). Many of these genes encode proteins with rhodanese-like homology domains, which are well-established sulfurtransferases. These enzymes typically carry sulfur in the form of a cysteine persulfide, a non-toxic but reactive equivalent of H2S (Palenchar et al., 2000; Matthies et al., 2005). Akin to rare cases of azoline-forming, partner-independent YcaOs, certain methanogens lack a bioinformatically identifiable TfuA (e.g. Methanopyrus kandleri and Methanocaldococcus sp., Figure 2). Whether these YcaOs act independently or use an as yet-unidentified partner protein remains to be seen. Clearly, further in vitro experimentation will be required to delineate the precise role of TfuA in the thioamidation reaction.

The viability of the ΔycaO-tfuA mutant raises significant questions as to the role of thioglycine in the native MCR enzyme, especially considering its universal presence in all MCRs examined to date. We considered three hypotheses to explain this result. First, we examined the possibility that thioglycine modification is involved in enhancing the reaction rate (Kahnt et al., 2007; Horng et al., 2001). Although it has not been explicitly determined, MCR is thought to catalyze the rate-limiting step of methanogenesis (Scheller et al., 2010; Wongnate et al., 2016). Therefore, the absence of thioglycine might lead to a corresponding decrease in the growth rate, with more pronounced defects on substrates that lead to the fastest growth. However, we observed the opposite: the most pronounced defects were observed with growth substrates that support the slowest WT growth rates (Table 1). Next, we considered the possibility that the thioglycine influences substrate affinity. C1 units enter methanogenesis at the level of N5-methyl-tetrahydrosarcinapterin (CH3-H4SPt) during growth on acetate (Galagan et al., 2002; Deppenmeier et al., 1999), but at the level of methyl-CoM during growth on DMS, methanol, and TMA (Figure 6) (Bose et al., 2008; Fu and Metcalf, 2015). Significantly, these entry points are separated by an energy-dependent step that is coupled to production or consumption of the trans-membrane Na+ gradient. As a result, intracellular levels of methyl-CoM, CoM, and CoB could possibly be significantly different depending on the entry point into the methanogenic pathway. Because we observed growth defects on substrates that enter at both points (i.e. DMS and acetate), we suspect that the growth deficiency phenotype is unlikely to be related to changes in substrate affinity. A third explanation we considered was that thioglycine increases the stability of MCR. In this model, unstable MCR protein would need to be replaced more often, creating a significant metabolic burden for the mutant. Consistent with our results, this additional burden would be exacerbated on lower energy substrates like DMS and acetate, especially given that MCR comprises ~10% of the total protein (Rospert et al., 1990). Further, one would expect that a protein stability phenotype would be exaggerated at higher temperatures, which we observed during growth on methanol (Figure 5). Thus, multiple lines of evidence support the idea that the growth-associated phenotypes stemming from the deletion of TfuA and YcaO are caused by decreased MCR stability. However, the melting temperature of MCR from the ∆ycao-tfuA mutant was modestly higher than that purified from the WT. As the thioglycine is buried deep within the active site of MCR (Ermler et al., 1997), these data are consistent with the notion that thioamidation does not affect the global stability of the protein. Instead, it suggests that the thioglycine modification impacts the local stability in the vicinity of the buried active site of MCR (Figure 1—figure supplement 1), which in turn might have a detrimental effect under catalytic turnover conditions.

An overview of methanogenic metabolism in M. acetivorans.

Methylotrophic substrates such as methanol (CH3OH) or dimethylsulfide (DMS, CH3-S-CH3) enter the methanogenic pathway via S-methylation of coenzyme M (CoM) and subsequently disproportionate to methane (CH4) and carbon dioxide (CO2; metabolic flux is shown as blue arrows). Notably, the first step in oxidation of CH3-CoM to CO2 is the energy-requiring transfer of the methyl moiety to generate methyl-tetrahydrosarcinapterin (CH3-H4SPt). In contrast, acetic acid (CH3COOH) enters the pathway at the CH3-H4SPt level, followed by reduction to CH4 (green arrows). Thus, the second step of the pathway is exergonic.


The chemical properties of amides relative to thioamides are consistent with our hypothesis. Although amides tend to be planar, their rotational barriers are lower than for the corresponding thioamide and thus they are more conformationally flexible. This is especially true for glycine. Considering the negligible electronegativity difference between sulfur and carbon, the thioamide carbonyl is not polarized like an amide carbonyl (Wiberg and Rablen, 1995). Further, sulfur has a larger van der Waals radius than oxygen resulting in a thioamide bond length that is ~40% longer than the amide bond (1.71 Å versus 1.23 Å) (Petersson et al., 2014), which presents additional steric hindrances to backbone flexibility. Finally, the pKa of thioamides is lower than amides, making thioglycine a stronger hydrogen bond donor than glycine (Lee et al., 2002), which again could reduce conformational flexibility. Taken together, it is chemically reasonable to state that the increased flexibility of the unmodified glycine in the ΔycaO-tfuA mutant would render the contorted conformation of the peptide backbone in the Gly462-Leu469 region of McrA considerably less stable (Figure 1—figure supplement 1). Indeed, this region adopts a rather strange configuration, with the side chain of Phe463 bending back towards the thioamide of Gly465. The molecular alignment and distance (3.5 Å) suggests a potential π-cation interaction between these residues(Figure 1—figure supplement 1) The thioamide sulfur is also optimally distanced (3.6 Å) and geometrically positioned to form an H-bond with the side chain of Asn501 and the backbone N-H of Leu469. There also appears to be a hydrophobic interaction between the thioamide and the beta carbon of Leu469, which would be energetically unfavorable with a more polarized amide. These observations suggest that the local stability in the vicinity of the active site imparted by the thioamide is required for protein stability and increased half-life of the MCR protein. A conclusive test of this hypothesis will require comprehensive structural and biochemical characterization of the active MCR variant lacking the thioglycine modification, which is beyond the scope of this work.

Finally, the temperature-sensitive phenotype of the ΔycaO-tfuA mutant has potential implications regarding the evolution and ecology of methanogenic archaea. Based on this result, it seems reasonable to speculate that the thioglycine modification would be indispensable for thermophilic methanogens. It is often posited that the ancestor of modern methanogens was a thermophilic organism (Gribaldo and Brochier-Armanet, 2006; Forterre, 2015; Weiss et al., 2016; López-García et al., 2015). If so, one would expect the thioglycine modification to be present in most methanogenic lineages, being stochastically lost due to genetic drift only in lineages that grow at low temperatures where the modification is not required. In contrast, if methanogenesis evolved in a cooler environment, one might expect the distribution of the modification to be restricted to thermophilic lineages. Thus, the universal presence of the thioglycine modification supports the thermophilic ancestry of methanogenesis. Indeed, the ycaO-tfuA locus is conserved even in Methanococcoides burtonii, a psychrophilic methanogen isolated from Ace Lake in Antarctica, where the ambient temperature is always below 2°C (Franzmann et al., 1992). It will be interesting to see whether this modification is maintained by other methanogenic and methanotrophic archaea growing in low temperature environments.

Materials and methods

Bioinformatics analyses

The 1000 closest homologs were extracted from the NCBI non-redundant protein database using the YcaO amino acid sequence (MA0165) or the TfuA amino acid sequence (MA0164) as queries in BLAST-P searches. The amino acid sequences of these proteins were aligned using the MUSCLE plug-in (Edgar, 2004) with default parameters in Geneious version R9 (Kearse et al., 2012). Approximate maximum-likelihood trees were generated using FastTree version 2.1.3 SSE3 using the Jones-Taylor-Thornton (JTT) model +CAT approximation with 20 rate categories. Branch support was calculated using the Shimodaira-Hasegawa (SH) test with 1000 resamples. Trees were displayed using Fig Tree v1.4.3 (http://tree.bio.ed.ac.uk/software/figtree/).

Strains, media, and growth conditions

All M. acetivorans strains were grown in single-cell morphology (Sowers et al., 1993) in bicarbonate-buffered high salt (HS) liquid medium containing 125 mM methanol, 50 mM trimethylamine hydrochloride (TMA), 40 mM sodium acetate, or 20 mM dimethylsulfide (DMS). Cultures were grown in sealed tubes with N2/CO2 (80/20) at 8–10 psi in the headspace. Most substrates were added to the medium prior to autoclaving. DMS was added from an anaerobic stock solution maintained at 4°C immediately prior to inoculation. Growth rate measurements were conducted with three independent biological replicate cultures acclimated to the energy substrate or temperature as indicated. A 1:10 dilution of a late-exponential phase culture was used as the inoculum for growth rate measurement. Plating on HS medium containing 50 mM TMA solidified with 1.7% agar was conducted in an anaerobic glove chamber (Coy Laboratory Products, Grass Lake, MI) as described previously (Metcalf et al., 1996). Solid media plates were incubated in an intra-chamber anaerobic incubator maintained at 37°C with N2/CO2/H2S (79.9/20/0.1) in the headspace as described previously (Metcalf et al., 1998). Puromycin (CalBiochem, San Diego, CA) was added to a final concentration of 2 μg/mL from a sterile, anaerobic stock solution to select for transformants containing the pac (puromycin transacetylase) cassette. The purine analog 8-aza-2,6-diaminopurine (8ADP) (R. I. Chemicals, San Diego, CA) was added to a final concentration of 20 µg/mL from a sterile, anaerobic stock solution to select against the hpt (phosphoribosyltransferase) cassette encoded on pC2A-based plasmids. Anaerobic, sterile stocks of tetracycline hydrochloride in deionized water were prepared fresh shortly before use and added to a final concentration of 100 µg/mL to the growth medium of strains containing ycaO and/or tfuA fused to PmcrB(tetO4). E. coli strains were grown in LB broth at 37°C with standard antibiotic concentrations. WM4489, a DH10B derivative engineered to control copy-number of oriV-based plasmids (Kim et al., 2012), was used as the host strain for all plasmids generated in this study (Supplementary file 1). Plasmid copy number was increased dramatically by supplementing the growth medium with sterile rhamnose to a final concentration of 10 mM.


All plasmids used in this study are listed in Supplementary file 1. Plasmids for Cas9-mediated genome editing were designed as described previously (Nayak and Metcalf, 2017). For designing the complementation plasmids, the ycaO and/or tfuA coding sequence(s) were amplified and fused to the PmcrB(tetO4) promoter in pJK029A (Guss et al., 2008) linearized with NdeI and HindIII by the Gibson assembly method as described previously in Nayak and Metcalf, 2017. Standard techniques were used for the isolation and manipulation of plasmid DNA. WM4489 was transformed by electroporation at 1.8 kV using an E. coli Gene Pulser (Bio-Rad, Hercules, CA). All pDN201-derived plasmids were verified by Sanger sequencing at the Roy J. Carver Biotechnology Center, University of Illinois at Urbana-Champaign and all pAMG40 cointegrates were verified by restriction endonuclease analysis.

In silico design of sgRNAs for gene-editing

All target sequences used for Cas9-mediated genome editing in this study are listed in Supplementary file 2. Target sequences were chosen using the CRISPR site finder tool in Geneious version R9 (61). The M. acetivorans chromosome and the plasmid pC2A were used to score off-target binding sites.

Transformation of M. acetivorans

All M. acetivorans strains used in this study are listed in Supplementary file 3. Liposome-mediated transformation was used for M. acetivorans as described previously (Metcalf et al., 1997) using 10 mL of late-exponential phase culture of M. acetivorans and 2 µg of plasmid DNA for each transformation.

In-gel tryptic digest of McrA

Mid-exponential phase cultures of M. acetivorans grown in 10 mL HS medium containing 50 mM TMA were harvested by centrifugation (3000 × g) for 15 min at 4°C (DuPont, Wilmington, DE). The cell pellet was resuspended in 1 mL lysis buffer (50 mM NH4HCO3, pH = 8.0) and harvested by centrifugation (17,500 × g) for 30 min at 4°C (DuPont, Wilmington, DE). An equal volume of the supernatant was mixed with 2 × Laemmli sample buffer (Bio-Rad, Hercules, CA) containing 5% β-mercaptoethanol, incubated in boiling water for 10 min, loaded on a 4–20% gradient Mini-Protean TGX denaturing SDS-PAGE gel (Bio-Rad, Hercules, CA) and run at 70 V until the dye-front reached the bottom of the gel. The gel was stained using the Gel Code Blue stain reagent (Thermo Fisher Scientific, Waltham, MA) as per the manufacturer’s instructions. Bands corresponding to McrA (ca. 60 kDa) were excised and cut into ca. 1 × 1 mm cubes. The gel slices from a single lane were destained with 50% acetonitrile, the corresponding protein was reduced with 10 mM dithiothreitol (DTT), and digested with 1.5 µg sequencing-grade trypsin (Promega, Madison, WI) at 37°C for 16–20 hr in the presence of 5% (v/v) n-propanol. The digested peptides were extracted and dried as described previously (Shevchenko et al., 2006).

MS analysis of tryptic peptides

MALDI-TOF-MS analysis was performed using a Bruker UltrafleXtreme MALDI TOF-TOF mass spectrometer (Bruker Daltonics, Billerica, MA) in reflector positive mode at the University of Illinois School of Chemical Sciences Mass Spectrometry Laboratory. The samples were desalted using C-18 zip-tips using aqueous acetonitrile and sinapic acid in 70% acetonitrile as the matrix. Data analysis was carried out using the Bruker FlexAnalysis software. For HR-ESI MS/MS, samples were dissolved in 35% aq. acetonitrile and 0.1% formic acid. Samples were directly infused using an Advion TriVersa Nanomate 100 into a ThermoFisher Scientific Orbitrap Fusion ESI-MS. The instrument was calibrated weekly, following the manufacturer’s instructions, and tuned daily with Pierce LTQ Velos ESI Positive Ion Calibration Solution (Thermo Fisher Scientific, Waltham, MA). The MS was operated using the following parameters: resolution, 100,000; isolation width (MS/MS), 1 m/z; normalized collision energy (MS/MS), 35; activation q value (MS/MS), 0.4; activation time (MS/MS), 30 ms. Data analysis was conducted using the Qualbrowser application of Xcalibur software (Thermo Fisher Scientific, Waltham, MA). HPLC-grade reagents were used to prepare samples for mass spectrometric analyses.

MCR purification

MCR was purified from 250 mL of mid-exponential phase culture grown in HS +50 mM TMA at 36°C. Protein purification was performed under aerobic conditions and cells were harvested by centrifugation (3000 × g) for 15 min at 4°C. The cell pellet was lysed in 5 mL of Wash buffer (50 mM NaH2PO4, 300 mM NaCl, pH = 8.0) and the cell lysate was clarified by centrifugation (17,500 × g) for 30 min at 4°C. The supernatant fraction was loaded on a column containing 2 mL Strep-tactin XT Superflow resin (50% suspension; IBA Lifesciences, Goettingen, Germany) equilibrated with 4 mL of the Wash buffer. The column was washed twice with 4 mL of Wash buffer and the purified protein was eluted in four fractions with 0.5 mL Elution buffer (50 mM NaH2PO4, 300 mM NaCl, 50 mM biotin, pH = 8.0) per fraction. The protein concentration in each fraction was estimated using the Coomassie Plus (Bradford) assay kit (Pierce Biotechnology, Thermo-Scientific, Rockford, IL, USA) with BSA (bovine serum albumin) as the standard per the manufacturer’s instructions. The highest protein concentration (ca. 600 μg/mL) was obtained in fraction 3 therefore this fraction was used to conduct the Thermofluor assay. To visualize the purified protein, 10 µL of the crude cell extract as well as fraction 3 were mixed with an equal volume of 2 × Laemmli sample buffer (Bio-Rad, Hercules, CA) containing 5% β-mercaptoethanol, incubated in boiling water for 10 min, loaded on a 4–20% gradient Mini-Protean TGX denaturing SDS-PAGE gel (Bio-Rad, Hercules, CA) and run at 70 V until the dye-front reached the bottom of the gel. The gel was stained using the Gel Code Blue stain reagent (Thermo Fisher Scientific, Waltham, MA) as per the manufacturer’s instructions. All three bands corresponding to the MCR subunits were observed and verified by LC-MS analyses of the tryptic peptides from fraction 3 of the purified protein sample at the Protein Sciences facility at the Roy J. Carver Biotechnology Center at the University of Illinois, Urbana-Champaign, USA. A fourth band, identified as a hypothetical protein encoded by MA3997, was also detected in each sample (Figure 5—figure supplement 1).

Thermofluor assay

A 5000 × concentrate of SYPRO Orange protein gel stain in DMSO (Thermo-Fisher Scientific, Waltham, MA, USA) was diluted with the Elution buffer to generate a 200 × stock solution. 5 µL of the 200 × stock solution of SYPRO Orange protein gel stain was added to 45 µL of purified protein with a concentration of ca. 600 µg/mL in 96-well optically clear PCR plates. A melt curve was performed on a Mastercycler ep realplex machine (Eppendorf, Hamburg, Germany) using the following protocol: 25°C for 30 s, ramp to 99°C over 30 min, return to 25°C for 30 s. SYPRO Orange fluorescence was detected using the VIC emission channel and the temperature corresponding to the inflection point of the first derivative (dI/dT) was determined to be the melting temperature (Tm). Appropriate no-dye controls and no-protein controls were examined and each sample was run in triplicate. The Thermofluor assay was conducted within 12 hr of protein purification.

UV-Vis spectrum of MCR

The spectrum was obtained on a Cary 4000 UV-Vis spectrophotometer (Varian, Palo Alto, CA, USA) using 200 µL of protein sample (1.5 µM each) in a quartz supracil cuvette (Hellma Analytics, Mullheim, Germany). The scanning range was 200–800 nm and the Elution buffer was used as a blank.


  1. 1
  2. 2
  3. 3
  4. 4
  5. 5
  6. 6
  7. 7
  8. 8
  9. 9
  10. 10
  11. 11
  12. 12
  13. 13
  14. 14
  15. 15
  16. 16
  17. 17
  18. 18
  19. 19
  20. 20
  21. 21
  22. 22
  23. 23
  24. 24
    The origin and evolution of Archaea: a state of the art
    1. S Gribaldo
    2. C Brochier-Armanet
    Philosophical Transactions of the Royal Society B: Biological Sciences 361:1007–1022.
  25. 25
  26. 26
  27. 27
  28. 28
  29. 29
  30. 30
  31. 31
  32. 32
  33. 33
  34. 34
  35. 35
  36. 36
  37. 37
  38. 38
  39. 39
  40. 40
  41. 41
  42. 42
  43. 43
    An anaerobic, intrachamber incubator for growth of Methanosarcina spp. on methanol-containing solid media
    1. WW Metcalf
    2. JK Zhang
    3. RS Wolfe
    Applied and Environmental Microbiology 64:768–770.
  44. 44
  45. 45
  46. 46
  47. 47
  48. 48
  49. 49
  50. 50
  51. 51
  52. 52
  53. 53
  54. 54
  55. 55
  56. 56
  57. 57
  58. 58
    Disaggregation of Methanosarcina spp. and Growth as Single Cells at Elevated Osmolarity
    1. KR Sowers
    2. JE Boone
    3. RP Gunsalus
    Applied and Environmental Microbiology 59:3832–3839.
  59. 59
  60. 60
  61. 61
  62. 62
  63. 63
  64. 64
  65. 65
  66. 66
  67. 67

Decision letter

  1. Dianne K Newman
    Reviewing Editor; Howard Hughes Medical Institute, California Institute of Technology, United States

In the interests of transparency, eLife includes the editorial decision letter and accompanying author responses. A lightly edited version of the letter sent to the authors after peer review is shown, indicating the most substantive concerns; minor comments are not usually included.

[Editors’ note: a previous version of this study was rejected after peer review, but the authors submitted for reconsideration. The first decision letter after peer review is shown below.]

Thank you for submitting your work entitled "Post-translational thioamidation of methyl-coenzyme M reductase, a key enzyme in methanogenic and methanotrophic Archaea" for consideration by eLife. Your article has been reviewed by four peer reviewers and the evaluation has been overseen by a Reviewing Editor and a Senior Editor. The following individuals involved in review of your submission have agreed to reveal their identity: Dianne K Newman (Reviewer #1) and Rudolph Thauer (Reviewer #4).

Our decision has been reached after consultation between the reviewers. Based on these discussions and the individual reviews below, we regret to inform you that your work will not be considered further for publication in eLife at this time.

While there is sincere enthusiasm for your work, and a desire to see it ultimately published in eLife, the consensus opinion is that, as the manuscript currently stands, the key finding - genetic demonstration that a thioglycine in MCR is installed by YcaO/TfuA and is not essential for catalytic activity - is not a sufficient advance to appeal to the broad eLife audience. Though we appreciate that comparing the catalytic activity of WT and mutant MCR is well beyond the scope of the manuscript, some other biochemical follow-up would significantly strengthen other claims of the manuscript (e.g. thermostability, mechanism of YcaO/TfuA, role of TfuA, etc). The evolutionary implications are intriguing, but not yet convincing. For example, why would MCR from Methanopyrus kandleri growing above 100°C and psychrophilic methanogens and methanotrophs both have the thioglycine in the active site of MCR conserved? And why would the thioglycine only show up in MCR? If you are able and willing to perform some additional experiments to bolster the claims in the manuscript, we would be happy to reconsider it for eLife.

Reviewer #1:

This manuscript presents strong evidence that 2 genes (tfuA and ycaO) are required for installation of a thioglycine into McrA, a critical enzyme in methanogenesis and in organisms that oxidize methane anaerobically. These processes are globally significant and challenging to study, so work that improves our understanding of how they function is attractive for publication in eLife.

Positives of the paper include clear writing and well-done genetic and MS experiments. The application of biochemical understanding from the natural product field to identify putitive genes catalyzing installation of a thioglycine in a methanogen is elegant and chemically satisfying. However, while the authors provide physiological data and reasonable logic arguing that the thioglycine confers greater stability to MCR, the evidence supporting this claim is indirect. One concern is that there is some other target of the modification other than McrA that is responsible for the observed phenotype. Perhaps this can be excluded as a possibility, but if so, the authors need to explain why that is. To a naïve reader, this seems like an important missing piece. One option would be to perform a limited set of biochemical experiments to look at McrA stability with and without the thioglycine residue. The authors argue this is beyond the scope of the paper, but is it really? Could this be done by looking for different sized bands of McrA on a western blot (might one predict differential stability would show up in different patterns on a protein gel)? How difficult is it to purify McrA and test for temperature stability for the WT and mutant versions? Alternatively, could a different mutation be introduced that would be predicted to render the McrA protein less thermostable, and could the phenotype be recapitulated? In the absence of biochemical data, that might strengthen the argument. How can the authors be confident that other proteins produced under the experimental conditions are not modified by TfuA/YcaO and responsible for the phenotypes? At a minimum, the authors need to directly address this concern in their discussion.

The Abstract and Discussion end with speculation about the implications of this work for an evolutionary hot start for methanogenesis. This is a bold claim, and the phylogenetic evidence is intriguing, but for this claim to be convincing, it is important to have solid evidence that the thioglycine in McrA is what causes the lack of thermostability. I would like to see this manuscript published in eLife, but encourage the authors to perform another experiment to strengthen this critical point.

Reviewer #2:

This paper addresses the biosynthesis and functional significance of a post-translational modification found in methyl-coenzyme M reductase, an enzyme that produces methane in anaerobic archaea and may also be involved in methane oxidation by methanotrophic archaea. Several post-translationally modified residues are present in or near the MCR active site in the McrA subunit, including a thioglycine. Candidate proteins for producing this thioamide include a YcaO homolog paired with a TfuA homolog. YcaOs catalyze formation of thiazolines from cysteines, and TfuA-like proteins are hypothesized to play a role in sulfur delivery and/or substrate recognition. Bioinformatic analysis presented here supports a role for these proteins in McrA thioamidation, and genetic disruption of both genes in Methanosarcina acetivorans coupled with mass spectrometric analysis indicates that the thioglycine is not formed in their absence. While the cells are still viable, some differences in growth are observed between the wildtype and ΔycaO-tfuA strains. In particular, the knockout strain grows more slowly on DMS and acetate, and more slowly on methanol if the temperature is raised. From these growth data, the authors suggest that the thioglycine modification does not affect MCR catalysis or substrate affinity, but instead increases its thermal stability. Although this model is consistent with the results, biochemical characterization of the MCR is essential to addressing this hypothesis. In addition, forming a thioamide seems like a metabolically expensive way to increase thermostability as many other proteins are thermostable without such post-translational modifications. The authors note that biochemical work is beyond the scope of this study, but I am not sure that the knockout alone merits publication in eLife; it seems more suited to a specialized journal.

In terms of thinking about the modification and its potential role in thermal stability or other aspects of function, it would be helpful to have a picture of the MCR active site showing where the glycine residue is located and what interactions it has with other residues.

Reviewer #3:

Metcalf et al. address interesting questions regarding post-translational modifications of the last enzyme of the methanogenic pathway in archaea. It has been known for almost two decades that some residues in the active site of the methyl-coenzyme M reductase (Mcr) are modified. Of particular interest is the thioamidation of glycine. The goal was to identify genes encoding enzymes responsible for this modification. The authors build a case for the analysis of two genes (ycaO, tfuA) that tracked in some cases immediately upstream to the Mcr operon. The authors use Methanosarcina acetivorans to perform phenotypic analyses of strains with deletions of the genes of interest. The observed growth phenotypes are explained on the basis of the entry point of different substrates into the methanogenic pathway. The results are consistent with the explanations provided. However, the authors do not validate the presumed biochemical activities of YcaO or TfuA, hence leading to much speculation. The effects reported here could be indirectly leading to the absence of thioamidated glycine. The authors start the Discussion section by stating '[…] these genes (ycaO, tfuA) are directly involved in the post-translational modification of McrA'; I disagree. To support such a statement the authors must show that YcaO/TfuA can modify McrA in vitro.

Reviewer #4:

The manuscript by Metcalf et al. for eLife describes the important finding that the post-translational installation of thioglycine in methyl-coenzyme M reductase in the methanogenic archaeon Methanosarcina acetivorans is mediated by the tfuA-ycaO locus. This experimental procedure showing this is perfect and the results obtained convincing. The excellent manuscript should be published after considering the following minor points:

Discussion paragraph three and following: Yes, MCR is generally thought to be the rate limiting enzyme in methanogenesis, however, the only step in methanogenesis that is physiologically irreversible, is the heterodisulfide reductase reaction rather than the MCR reaction. Thus MCR is most probably not rate limiting. This should be considered or at least discussed.

Of the many glycins in McrA only one is converted to a thioglycin and this glycine is buried deep within the McrABC complex. The post-translational modification must therefore occur as long as the protein is not yet folded. Generally enzymes mediating post-translational modifications specifically recognize the sequence upstream and downstream of the amino acid to be modified. Could the authors comment on this in the manuscript with a few sentences?

[Editors’ note: what now follows is the decision letter after the authors submitted for further consideration.]

Thank you for resubmitting your work entitled "Post-translational thioamidation of methyl-coenzyme M reductase, a key enzyme in methanogenic and methanotrophic Archaea" for further consideration at eLife. Your revised article has been favorably evaluated by Gisela Storz (Senior editor) and four reviewers, one of whom is a member of our Board of Reviewing Editors.

We appreciate your efforts to respond to our feedback by performing new experiments and revising the text accordingly. The manuscript has been improved but there are some remaining issues that need to be addressed before acceptance, as outlined below:

The consensus is that in the absence of supporting biochemical data, the manuscript still pushes a mechanistic message too strongly. Please moderate the discussion. Your results have shown that the thioglycine within the active site is not essential for full activity, not that it lacks a direct catalytic role. In addition, the paragraph on the discussion of growth phenotypes is convoluted and overly speculative. It would be better to tighten and moderate this paragraph, in the absence of supporting data. Growth phenotypes should also be mentioned in the Abstract, so it is clear that the phenotype of the double mutant extends beyond the lack of a PTM. While we agree that additional biochemical experiments are outside the scope of this work, for this manuscript to be published in eLife as a genetics/physiology paper, these aspects need to be airtight. Towards that end, please include complementation experiments for the mutants.

With these modifications, we anticipate your second revision would be publishable in eLife.

Reviewer #1:

The new experiments and revisions to the text have alleviated my previous concerns and the manuscript is much improved.

While there are many questions remaining that need to be addressed at the biochemical level, this study has made an important new contribution and is done rigorously.

Reviewer #2:

This is a revised version in which the authors have addresses most of the questions and suggestions made by the reviewers. The interpretations remain speculative but the experimental results are too important not to be published.

Reviewer #3:

In the revised version of this manuscript, Metcalf et al. show that strains carrying null alleles of tfuA or ycaO do not modify the glycine of interest. In addition, results from new experiments show that thioglycine is not needed to stabilize MCR. The new hypothesis is now that the stabilizing effect occurs at the level of the active site; that idea was not tested. In the absence of experimental data, the authors softened the wording regarding the direct involvement of TfuA and YcaO.

Without a question, this is a very interesting problem, but I am not convinced that the revised paper has reached the level of an eLife publication.

Reviewer #4:

In this revised manuscript, the authors have added two experiments. First, they have constructed separate knockouts of ycaO and tfuA as well as the double knockout, and demonstrate by mass spectrometric analysis that both are necessary for thioglycine formation. This is not surprising. Second, they have isolated the MCR produced by the double knockout strain and show that its melting temperature is unchanged, disproving their previous hypothesis regarding thermal stability. They have revised the hypothesis to invoke localized stability at the active site; the overall argument regarding the properties of amides versus thioamides is the same. A stability experiment is one of the approaches the editor suggested as biochemical follow up so in that sense, the authors have done what was requested.


Author response

[Editors’ note: the author responses to the first round of peer review follow.]

Reviewer #1:

This manuscript presents strong evidence that 2 genes (tfuA and ycaO) are required for installation of a thioglycine into McrA, a critical enzyme in methanogenesis and in organisms that oxidize methane anaerobically. These processes are globally significant and challenging to study, so work that improves our understanding of how they function is attractive for publication in eLife.

Positives of the paper include clear writing and well-done genetic and MS experiments. The application of biochemical understanding from the natural product field to identify putitive genes catalyzing installation of a thioglycine in a methanogen is elegant and chemically satisfying. However, while the authors provide physiological data and reasonable logic arguing that the thioglycine confers greater stability to MCR, the evidence supporting this claim is indirect. One concern is that there is some other target of the modification other than McrA that is responsible for the observed phenotype. Perhaps this can be excluded as a possibility, but if so, the authors need to explain why that is. To a naïve reader, this seems like an important missing piece. One option would be to perform a limited set of biochemical experiments to look at McrA stability with and without the thioglycine residue. The authors argue this is beyond the scope of the paper, but is it really? Could this be done by looking for different sized bands of McrA on a western blot (might one predict differential stability would show up in different patterns on a protein gel)? How difficult is it to purify McrA and test for temperature stability for the WT and mutant versions? Alternatively, could a different mutation be introduced that would be predicted to render the McrA protein less thermostable, and could the phenotype be recapitulated? In the absence of biochemical data, that might strengthen the argument. How can the authors be confident that other proteins produced under the experimental conditions are not modified by TfuA/YcaO and responsible for the phenotypes? At a minimum, the authors need to directly address this concern in their discussion.

We thank the reviewer for their insightful critique. We recognize that we had not rigorously shown that the in vivo phenotype resulting from the ycaO-tfuA deletion is due to an affect on MCR (rather than on some unidentified target of ycaO/tfuA) and we have made a dedicated effort to address this. To do this, we introduced affinity tag at the N-terminus of the mcrG CDS in the WT strain as well as in a strain lacking the ycaO-tfuA locus in order to aid purification and studies of MCR. (As a side note, this is the first time affinity purification of MCR has been conducted in the native host.) A SYPRO-orange based Thermofluor assay was performed with MCR purified aerobically from each of these strains (Figure 5—figure supplement 1) to determine the melting temperature of the complex containing all three subunits. We did not observe any significant difference in the melting temperature of the MCR complex lacking thioglycine under these conditions. Also, the content of F430 cofactor was unchanged between WT and mutant as determined by UV-Vis spectroscopy.

The outcome of these critical experiments suggests that thioglycine does not affect the global stability of the MCR complex; however, local instability in the region of the MCR active site, which is buried within the α subunit (McrA), cannot be confirmed nor refuted at this time. While we are interested in determining the precise role of the thioglycine, the requisite anaerobic biochemical interrogation of the protein is beyond the scope of the current study.

In addition, a comprehensive proteomic analysis might determine if YcaO/TfuA modify other proteins, but it would be impossible to obtain 100% coverage of all peptides in such an experiment. Therefore, a negative result would still be inconclusive. Given the associated cost and effort required to conduct such an experiment, we feel this is not worth pursuing at this time.

The Abstract and Discussion end with speculation about the implications of this work for an evolutionary hot start for methanogenesis. This is a bold claim, and the phylogenetic evidence is intriguing, but for this claim to be convincing, it is important to have solid evidence that the thioglycine in McrA is what causes the lack of thermostability. I would like to see this manuscript published in eLife, but encourage the authors to perform another experiment to strengthen this critical point.

Given the inconclusive data cited above, we have significantly softened this argument in the revised version.

Reviewer #2:

This paper addresses the biosynthesis and functional significance of a post-translational modification found in methyl-coenzyme M reductase, an enzyme that produces methane in anaerobic archaea and may also be involved in methane oxidation by methanotrophic archaea. Several post-translationally modified residues are present in or near the MCR active site in the McrA subunit, including a thioglycine. Candidate proteins for producing this thioamide include a YcaO homolog paired with a TfuA homolog. YcaOs catalyze formation of thiazolines from cysteines, and TfuA-like proteins are hypothesized to play a role in sulfur delivery and/or substrate recognition. Bioinformatic analysis presented here supports a role for these proteins in McrA thioamidation, and genetic disruption of both genes in Methanosarcina acetivorans coupled with mass spectrometric analysis indicates that the thioglycine is not formed in their absence. While the cells are still viable, some differences in growth are observed between the wildtype and ΔycaO-tfuA strains. In particular, the knockout strain grows more slowly on DMS and acetate, and more slowly on methanol if the temperature is raised. From these growth data, the authors suggest that the thioglycine modification does not affect MCR catalysis or substrate affinity, but instead increases its thermal stability. Although this model is consistent with the results, biochemical characterization of the MCR is essential to addressing this hypothesis. In addition, forming a thioamide seems like a metabolically expensive way to increase thermostability as many other proteins are thermostable without such post-translational modifications. The authors note that biochemical work is beyond the scope of this study, but I am not sure that the knockout alone merits publication in eLife; it seems more suited to a specialized journal.

As noted by other reviewers, and in the letter from the Editor, biochemical characterization of MCR is truly beyond the scope of this manuscript. During the purification process, the Ni(I) in F430 is especially prone to oxidation to Ni(II) and reductive activation of the enzyme in vitro is especially challenging and has only been demonstrated for the MCR from a different, distantly related organism (Methanothermobacter marburgensis; Prakash et al. J. Bac 2014). To circumvent this issue, MCR in the cells is oxidized to the stable Ni(III) form in vivo prior to purification, and Ni(III) is reduced to Ni(I) in vitro by the addition of titanium citrate as a reductant. Protocols for the conversion of MCR to the Ni(III) form vary significantly across different methanogenic strains and a robust protocol for M. acetivorans has not been developed yet. We hope to conduct such studies in the future and with this paper we have the motivation to do so.

In terms of thinking about the modification and its potential role in thermal stability or other aspects of function, it would be helpful to have a picture of the MCR active site showing where the glycine residue is located and what interactions it has with other residues.

We have added a new figure supplement (Figure 1—figure supplement 1) to depict the location of the modified thioglycine residue relative to coenzyme B, coenzyme M, F430, as well as the interaction that it has with other residues in the vicinity.

Reviewer #3:

Metcalf et al. address interesting questions regarding post-translational modifications of the last enzyme of the methanogenic pathway in archaea. It has been known for almost two decades that some residues in the active site of the methyl-coenzyme M reductase (Mcr) are modified. Of particular interest is the thioamidation of glycine. The goal was to identify genes encoding enzymes responsible for this modification. The authors build a case for the analysis of two genes (ycaO, tfuA) that tracked in some cases immediately upstream to the Mcr operon. The authors use Methanosarcina acetivorans to perform phenotypic analyses of strains with deletions of the genes of interest. The observed growth phenotypes are explained on the basis of the entry point of different substrates into the methanogenic pathway. The results are consistent with the explanations provided. However, the authors do not validate the presumed biochemical activities of YcaO or TfuA, hence leading to much speculation. The effects reported here could be indirectly leading to the absence of thioamidated glycine. The authors start the Discussion section by stating '[…] these genes (ycaO, tfuA) are directly involved in the post-translational modification of McrA'; I disagree. To support such a statement the authors must show that YcaO/TfuA can modify McrA in vitro.

We agree with the reviewer that in vitro experiments would need to be done to prove that YcaO/TfuA directly modify McrA. Thus, we have modified the first sentence of the Discussion section to soften our stance on the direct involvement of TfuA/YcaO in the post-translational installation of thioglycine. However, we have added additional data showing that both proteins are required in vivo. To do this, we have generated single mutants lacking either ycaO or tfuA and conducted MS analyses of McrA from each of these strains. Our results (subsection “The ∆ycaO-tfuA mutant lacks the McrA Gly465 thioamide” and Figure 4) indicate that both genes seem to be required for the installation of the thioamide bond.

Reviewer #4:

The manuscript by Metcalf et al. for eLife describes the important finding that the post-translational installation of thioglycine in methyl-coenzyme M reductase in the methanogenic archaeon Methanosarcina acetivorans is mediated by the tfuA-ycaO locus. This experimental procedure showing this is perfect and the results obtained convincing. The excellent manuscript should be published after considering the following minor points:

Discussion paragraph three and following: Yes, MCR is generally thought to be the rate limiting enzyme in methanogenesis, however, the only step in methanogenesis that is physiologically irreversible, is the heterodisulfide reductase reaction rather than the MCR reaction. Thus MCR is most probably not rate limiting. This should be considered or at least discussed.

We have addressed the reviewer’s comment in the Discussion section.

Of the many glycins in McrA only one is converted to a thioglycin and this glycine is buried deep within the McrABC complex. The post-translational modification must therefore occur as long as the protein is not yet folded. Generally enzymes mediating post-translational modifications specifically recognize the sequence upstream and downstream of the amino acid to be modified. Could the authors comment on this in the manuscript with a few sentences?

We have briefly discussed the putative roles of TfuA, including being involved in sequence recognition in the Discussion.

[Editors' note: the author responses to the re-review follow.]

The consensus is that in the absence of supporting biochemical data, the manuscript still pushes a mechanistic message too strongly. Please moderate the discussion. Your results have shown that the thioglycine within the active site is not essential for full activity, not that it lacks a direct catalytic role. In addition, the paragraph on the discussion of growth phenotypes is convoluted and overly speculative. It would be better to tighten and moderate this paragraph, in the absence of supporting data. Growth phenotypes should also be mentioned in the Abstract, so it is clear that the phenotype of the double mutant extends beyond the lack of a PTM.

We have modified the Discussion to soften our stance on the mechanistic underpinnings of the thioglycine modification (Discussion, paragraph three). The growth phenotypes are now discussed in the Abstract.

While we agree that additional biochemical experiments are outside the scope of this work, for this manuscript to be published in eLife as a genetics/physiology paper, these aspects need to be airtight. Towards that end, please include complementation experiments for the mutants.

As requested by the editor, we have performed complementation experiments for each of the mutants (∆ycao-tfuA, ∆ycaO, and ∆tfuA). Details pertaining to these experiments can be found in the Results section (subsection “The ∆ycaO-tfuA mutant lacks the McrA Gly465 thioamide”) and also in Figure 4 Panels E, F, G.


Article and author information

Author details

  1. Dipti D Nayak

    Carl R. Woese Institute for Genomic Biology, University of Illinois, Urbana, United States
    Conceptualization, Data curation, Formal analysis, Supervision, Funding acquisition, Investigation, Methodology, Writing—original draft, Project administration, Writing—review and editing
    Competing interests
    No competing interests declared
    ORCID icon 0000-0002-8390-7251
  2. Nilkamal Mahanta

    Department of Chemistry, University of Illinois, Urbana, United States
    Data curation, Formal analysis, Investigation, Writing—original draft, Writing—review and editing
    Competing interests
    No competing interests declared
    ORCID icon 0000-0001-8901-2531
  3. Douglas A Mitchell

    1. Carl R. Woese Institute for Genomic Biology, University of Illinois, Urbana, United States
    2. Department of Chemistry, University of Illinois, Urbana, United States
    3. Department of Microbiology, University of Illinois, Urbana, United States
    Conceptualization, Supervision, Funding acquisition, Writing—original draft, Project administration, Writing—review and editing
    For correspondence
    Competing interests
    No competing interests declared
    ORCID icon 0000-0002-9564-0953
  4. William W Metcalf

    1. Carl R. Woese Institute for Genomic Biology, University of Illinois, Urbana, United States
    2. Department of Microbiology, University of Illinois, Urbana, United States
    Conceptualization, Data curation, Formal analysis, Supervision, Funding acquisition, Investigation, Methodology, Writing—original draft, Project administration, Writing—review and editing
    For correspondence
    Competing interests
    No competing interests declared
    ORCID icon 0000-0002-0182-0671


National Institute of General Medical Sciences (GM097142)

  • Douglas A Mitchell

Life Sciences Research Foundation (Simons Foundation)

  • Dipti D Nayak

U.S. Department of Energy (DE-FG02-02ER15296)

  • William W Metcalf

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.


We thank Graham A Hudson (DAM lab) for technical assistance with the HR and tandem MS data acquisition and Dr. Peter Yau at the Protein Sciences facility at the Roy J Carver Biotechnology Center at the University of Illinois for identifying the protein that co-purified with MCR.

Reviewing Editor

  1. Dianne K Newman, Reviewing Editor, Howard Hughes Medical Institute, California Institute of Technology, United States

Publication history

  1. Received: June 2, 2017
  2. Accepted: August 11, 2017
  3. Version of Record published: September 7, 2017 (version 1)


© 2017, Nayak et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.


  • 1,123
    Page views
  • 187
  • 10

Article citation count generated by polling the highest count across the following sources: Scopus, Crossref, PubMed Central.

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Downloads (link to download the article as PDF)

Download citations (links to download the citations from this article in formats compatible with various reference manager tools)

Open citations (links to open the citations from this article in various online reference manager services)

Further reading

    1. Epidemiology and Global Health
    2. Microbiology and Infectious Disease
    Ellie Sherrard-Smith et al.
    Research Article
    1. Microbiology and Infectious Disease
    Aspen T Reese et al.
    Research Article