Extrinsic activin signaling cooperates with an intrinsic temporal program to increase mushroom body neuronal diversity
Abstract
Temporal patterning of neural progenitors leads to the sequential production of diverse neurons. To understand how extrinsic cues influence intrinsic temporal programs, we studied Drosophila mushroom body progenitors (neuroblasts) that sequentially produce only three neuronal types: γ, then α’β’, followed by αβ. Opposing gradients of two RNA-binding proteins Imp and Syp comprise the intrinsic temporal program. Extrinsic activin signaling regulates the production of α’β’ neurons but whether it affects the intrinsic temporal program was not known. We show that the activin ligand Myoglianin from glia regulates the temporal factor Imp in mushroom body neuroblasts. Neuroblasts missing the activin receptor Baboon have a delayed intrinsic program as Imp is higher than normal during the α’β’ temporal window, causing the loss of α’β’ neurons, a decrease in αβ neurons, and a likely increase in γ neurons, without affecting the overall number of neurons produced. Our results illustrate that an extrinsic cue modifies an intrinsic temporal program to increase neuronal diversity.
Introduction
The building of intricate neural networks during development is controlled by highly coordinated patterning programs that regulate the generation of different neuronal types in the correct number, place and time. The sequential production of different neuronal types from individual progenitors, i.e. temporal patterning, is a conserved feature of neurogenesis (Cepko, 2014; Holguera and Desplan, 2018; Kohwi and Doe, 2013; Lodato and Arlotta, 2015). For instance, individual radial glia progenitors in the vertebrate cortex sequentially give rise to neurons that occupy the different cortical layers in an inside-out manner (Gao et al., 2014; Llorca et al., 2019). In Drosophila, neural progenitors (called neuroblasts) also give rise to different neuronal types sequentially. For example, projection neurons in the antennal lobe are born in a stereotyped temporal order and innervate specific glomeruli (Jefferis et al., 2001; Kao et al., 2012; Yu et al., 2010). In both of these examples, individual progenitors age concomitantly with the developing animal (e.g., from embryonic stages 11–17 in mouse and from the first larval stage (L1) to the end of the final larva stage (L3) in Drosophila). Thus, these progenitors are exposed to changing environments that could alter their neuronal output. Indeed, classic heterochronic transplantation experiments demonstrated that young cortical progenitors placed in an old host environment alter their output to match the host environment and produce upper-layer neurons (Desai and McConnell, 2000; McConnell, 1988; McConnell and Kaznowski, 1991).
The adult Drosophila central brain is built from ~100 neuroblasts (Lee et al., 2020; Urbach and Technau, 2004; Wong et al., 2013; Yu et al., 2013a) that divide continuously from L1 to L3 (Homem et al., 2014; Sousa-Nunes et al., 2010; Yang et al., 2017). Each asymmetric division regenerates the neuroblast and produces an intermediate progenitor called ganglion mother cell (GMC) that divides only once, typically producing two different cell types (Lin et al., 2010; Spana and Doe, 1996; Truman et al., 2010). Thus, during larval life central brain neuroblasts divide 50–60 times, sequentially producing many different neuronal types. All central brain neuroblasts progress through opposing temporal gradients of two RNA-binding proteins as they age: IGF-II mRNA binding protein (Imp) when they are young and Syncrip (Syp) when they are old (Liu et al., 2015; Syed et al., 2017b; Syed et al., 2017a; Yang et al., 2016). Loss of Imp or Syp in antennal lobe or Type II neuroblasts affects the ratio of young to old neuronal types (Liu et al., 2015; Ren et al., 2017). Imp and Syp also affect neuroblast lifespan (Yang et al., 2017). Thus, a single temporal program can affect both the diversity of neuronal types produced and their numbers.
Since central brain neuroblasts produce different neuronal types through developmental time, roles for extrinsic cues have recently garnered attention. Ecdysone triggers all the major developmental transitions including progression into the different larval stages and entry in pupation (Yamanaka et al., 2013). The majority of central brain neuroblasts are not responsive to ecdysone until mid-larval life when they begin to express the Ecdysone Receptor (EcR) (Syed et al., 2017a). Expressing a dominant-negative version of EcR (EcR-DN) in Type II neuroblasts delays the Imp to Syp transition that normally occurs ~60 hr after larval hatching (ALH). This leads to many more cells that express the early-born marker gene Repo and fewer cells that express the late-born marker gene Bsh.
To further understand how extrinsic signals contribute to temporal patterning, we studied Drosophila mushroom body neuroblasts because of the deep understanding of their development. The mushroom body is comprised of ~2000 neurons (Kenyon cells) that belong to only three main neuronal types that have unique morphologies and play distinct roles in learning and memory (Cognigni et al., 2018; Ito et al., 1997; Lee et al., 1999). They receive input mainly from ~200 projection neurons that each relays odor information from olfactory receptor neurons (Vosshall and Stocker, 2007). Each projection neuron connects to a random subset of Kenyon cells and each Kenyon cell receives input from ~7 different projection neurons (Jefferis et al., 2007; Murthy et al., 2008; Turner et al., 2008). This connectivity pattern requires a large number of mushroom body neurons (~2,000) to represent complex odors (Hige, 2018). To produce this very large number of neurons, mushroom body development is unique in many respects. Mushroom body neurons are born from four identical neuroblasts that divide continuously (unlike any other neuroblast) from the late embryonic stages until the end of pupation (~9 days for ~250 divisions each) (Figure 1A; Ito et al., 1997; Kraft et al., 2016; Kunz et al., 2012; Kurusu et al., 2009; Lee et al., 1999; Pahl et al., 2019; Siegrist et al., 2010; Sipe and Siegrist, 2017). Furthermore, the two neurons born from each mushroom body GMC are identical. The neuronal simplicity of the adult mushroom body makes it ideal to study how extrinsic cues might affect diversity since the loss of any single neuronal type is obvious given that each is represented hundreds of times.
The three main neuronal types that make up the adult mushroom body are produced sequentially during neurogenesis: first γ, followed by α’β’, and then αβ neurons (Lee et al., 1999; Figure 1A), representing the simplest lineage in the central brain. The γ temporal window extends from L1 (the first larval stage) until mid-L3 (the final larval stage) when animals attain critical weight and are committed to metamorphosis; the α’β’ window from mid-L3 to the beginning of pupation, and the αβ window from pupation until eclosion (the end of development). Like all other central brain neuroblasts Imp and Syp are expressed by mushroom body neuroblasts, but in much shallower gradients through time, which accounts for their extended lifespan (Liu et al., 2015; Yang et al., 2017). Imp and Syp are inherited by newborn neurons where they instruct temporal identity. Imp positively and Syp negatively regulate the translation of chronologically inappropriate morphogenesis (chinmo), a gene encoding a transcription factor that acts as a temporal morphogen in neurons (Kao et al., 2012; Ren et al., 2017; Zhu et al., 2006). The first-born γ neurons are produced for the first ~85 cell divisions, when Imp levels in neuroblasts, and thus Chinmo in neurons, are high. α’β’ neurons are produced for the next ~40 divisions, when Imp and Syp are at similar low levels that translate into lower Chinmo levels in neurons. Low Chinmo then regulates the expression in neurons of maternal gene required for meiosis (mamo), which encodes a transcription factor that specifies the α’β’ fate and whose mRNA is stabilized by Syp (Liu et al., 2019). αβ neurons are generated for the final ~125 neuroblast divisions, when Syp levels are high, Imp is absent in neuroblasts, and thus Chinmo and Mamo are no longer expressed in neurons.
Extrinsic cues are known to have important roles in regulating neuronal differentiation during mushroom body neurogenesis. The ecdysone peak that controls entry into pupation regulates γ neuron axonal remodeling (Lee et al., 2000). Ecdysone was also proposed to be required for the final differentiation of α’β’ neurons (Marchetti and Tavosanis, 2017). EcR expression in γ neurons is timed by activin signaling, a member of the TGFβ family, from local glia (Awasaki et al., 2011; Zheng et al., 2003). Activin signaling from glia is also required for the α’β’ fate (Marchetti and Tavosanis, 2019): Knocking-down the activin pathway receptor Baboon (Babo) leads to the loss of α’β’ neurons. It was proposed that activin signaling in mushroom body neuroblasts regulates the expression of EcR in prospective α’β’ neurons and that when the activin pathway is inhibited, it leads to the transformation of α’β’ neurons into later-born pioneer-αβ neurons (a subclass of the αβ class) (Marchetti and Tavosanis, 2019).
Although there is strong evidence that extrinsic cues have important functions in neuronal patterning in the Drosophila central brain, it remains unknown how extrinsic temporal cues interface with the Imp and Syp intrinsic temporal program to regulate neuronal specification. Here we address this question using the developing mushroom bodies. We independently discovered that activin signaling from glia is required for α’β’ specification. However, we show that activin signaling lowers the levels of the intrinsic factor Imp in mushroom body neuroblasts to define the mid-α’β’ temporal identity window. Removing the activin receptor Babo in mutant clones leads to the loss of α’β’ neurons, to fewer last-born αβ neurons, and to the likely generation of additional first-born γ neurons without affecting overall clone size. This appears to be caused by a delayed decrease in Imp levels, although the intrinsic temporal clock still progresses even in the absence of activin signaling. We also demonstrate that ecdysone signaling is not necessary for the specification of α’β’ neurons, although it might still be involved in later α’β’ differentiation. Our results provide a model for how intrinsic and extrinsic temporal programs operate within individual progenitors to regulate neuronal specification.
Results
α’β’ neurons are not generated from babo mutant neuroblasts
The production of the three different mushroom body neuronal types occurs within specific developmental stages of larval and pupal development. That is, the γ window extends from L1 to mid-L3, the α’β’ window from mid-L3 to pupation, and the αβ window from pupation to eclosion (Figure 1A; Lee et al., 1999). This means that extrinsic cues could play a role in controlling or fine-tuning transitions between these temporal windows. Additionally, the specification of neuronal identity within each temporal window could be aided by extrinsic cues. To test these hypotheses, we used Mosaic Analysis with a Repressible Cell Marker (MARCM) (Lee and Luo, 1999) to test the function of receptors for inter-cellular signaling pathways with known roles either in mushroom body neurogenesis (Activin and Ecdysone) (Lee et al., 2000; Marchetti and Tavosanis, 2017; Marchetti and Tavosanis, 2019; Zheng et al., 2003) or more broadly during nervous system development (Hedgehog and juvenile hormone) (Figure 1—figure supplement 1A–H; Baumann et al., 2017; Chai et al., 2013). We induced mushroom body neuroblast clones at L1 and compared the axonal morphologies of adult neurons born from mutant neuroblasts to neurons born from surrounding wildtype neuroblasts. To identify mushroom body axonal lobes (both mutant and wildtype), we used antibodies to the Rho guanine exchange factor Trio (a weak γ and strong α’β’ cytoplasmic marker) and to the cell adhesion molecule Fasciclin II (FasII) (an axonal γ and αβ marker) (Figure 1B; Awasaki et al., 2000; Crittenden et al., 1998). To visualize mushroom body neurons within clones we expressed UAS-CD8::GFP under the control of OK107-Gal4 (referred to as mb-Gal4 hereafter), a Gal4 enhancer trap in eyeless and a common mushroom body Gal4 driver that strongly labels all mushroom body neuronal types during development and in the adult, and weakly mushroom body neuroblasts and young neurons throughout development (Connolly et al., 1996; Liu et al., 2015; Zhu et al., 2006).
In wildtype clones induced at L1, GFP+ axons projected to all five mushroom body lobes: α, α΄, β, β’ (hidden behind the γ lobe in max projections), and γ (Figure 1D, Figure 1—figure supplement 1A). In clones mutant for babo, we did not detect GFP+ axons within the α’β’ lobes, which remained visible by Trio staining due to the presence of wildtype α’β’ neurons (Figure 1E, Figure 1—figure supplement 1B). In addition, and as previously described, γ neurons within babo mutant clones remained unpruned (visualized by vertical GFP+ axons that were Trio+ and FasII+), providing a positive control since γ remodeling is known to require activin signaling (Figure 1E, Figure 1—figure supplement 1B; Awasaki et al., 2011; Yu et al., 2013b; Zheng et al., 2003).
Babo is the sole Type I receptor in the activin pathway (a member of the TGFβ family of signaling molecules). Babo with its Type II co-receptors binds four different activin ligands and acts through the transcription factor Smad on X (Smad2) (Brummel et al., 1999; Upadhyay et al., 2017). We induced Smad2 mutant clones at L1 and characterized adult axonal morphologies. Similar to babo mutant clones, Smad2 clones were missing α’β’ neurons and also contained unpruned γ neurons (Figure 1—figure supplement 1I).
The absence of GFP+ axons within the α’β’ lobes in babo mutant clones could be due to the loss of axonal projections, or to the loss of neuronal identity. Using antibodies against Trio and Mamo that strongly label α’β’ neuron cell bodies in the adult (Figure 1B, Figure 1—figure supplement 1J; Alyagor et al., 2018; Awasaki et al., 2000; Croset et al., 2018; Liu et al., 2019), we detected strong Trio+ and Mamo+ cells within adult GFP+ clones induced at L1 (Figure 1F, Figure 1—figure supplement 1K). In babo mutant clones however, the vast majority of strong Trio+ and Mamo+ cells inside clones were missing compared to surrounding wildtype neurons (Figure 1G, Figure 1—figure supplement 1L), suggesting that α’β’ neurons were not specified. We quantified the number of α’β’ neurons in wildtype and babo clones by counting the number of strong Mamo+ cells within a clone versus the total number of strong Mamo+ cells outside the clone. In wildtype MARCM clones affecting a single mushroom body neuroblast (n = 7), the percentage of all α’β’ neurons that were present within the clones was 25.5 ± 0.7%, the expected ratio since each mushroom body is built from four identical neuroblasts (Figure 1H; Ito et al., 1997; Lee et al., 1999). In comparison, in babo mutant clones (n = 8) the percentage of α’β’ neurons within clones was 2.2 ± 0.4% (Figure 1H). Interestingly, although there was a decrease in the number of adult α’β’ neurons upon expression of UAS-babo-RNAi with mb-Gal4, the majority of α’β’ neurons were not lost (Figure 1—figure supplement 1M–Q). Importantly, γ neurons in these brains did not remodel (Figure 1—figure supplement 1P–P’’’), indicating that the babo-RNAi worked efficiently. This difference with babo clones is likely due to the weak expression of mb-Gal4 in neuroblasts and newborn neurons and suggested to us that activin signaling is necessary for α’β’ specification by acting in neuroblasts (see below).
We next sought to determine the fate of the missing α’β’ neurons in babo clones, particularly since there was no significant difference in average clone sizes between mutant and control clones labeled with mb-Gal4 (wildtype: clone size = 533.6 ± 33.3, n = 7; babo: clone size = 551.3 ± 17.6, n = 7) (Figure 1H’), which suggests that there is no defect in neuroblast proliferation, and that α’β’ neurons are not lost by cell death in babo clones. However, to directly test whether cell death played a role, we expressed the caspase inhibitor P35 in babo mutant clones (Figure 1—figure supplement 2A). However, α’β’ neurons were still missing in the adult (Figure 1—figure supplement 2A), indicating that α’β’ neurons are not generated and then die. We thus tested whether the γ or αβ temporal windows were extended in babo mutant clones. We made MARCM clones in which the γ, α’β’ or αβ neurons were specifically marked with different Gal4 lines, and then quantified the total number of GFP+ neurons in wildtype versus babo mutant clones (Figure 1I–K, Figure 1—figure supplement 2B–M). Using R71G10-Gal4 (Issman-Zecharya and Schuldiner, 2014) (referred to as γ-Gal4), the average number of γ neurons trended higher in babo mutant clones, although not significantly (wildtype: 154.3 ± 11.4, n = 10; babo: 178.4 ± 11.9, n = 12) (Figure 1I, Figure 1—figure supplement 2B–E), likely because the number of γ neurons directly depends on the time of clone induction. α’β’ neurons, marked by R41C07-Gal4 (referred to as α’β’-Gal4), were mostly missing in babo mutant clones compared to wildtype clones (wildtype: 81.5 ± 3.6, n = 4; babo: 2.1 ± 0.5, n = 8,) consistent with our previous results when counting strong Mamo+ cells in babo clones marked by mb-Gal4 (Figure 1H, Figure 1J, Figure 1—figure supplement 2F–I). The average number of αβ neurons, marked by R44E04-Gal4 (referred to as αβ-Gal4), was significantly reduced in babo versus wildtype clones (wildtype: 276 ± 9.1, n = 7,; babo: 228.9 ± 13.2, n = 8) (Figure 1K, Figure 1—figure supplement 2J–M). Together, these results suggest that additional γ neurons are likely produced, and that fewer αβ neurons are generated, in babo mutant clones. Although this might appear to contradict a recent report that showed that a subclass of αβ neurons (pioneer-αβ) increases (Marchetti and Tavosanis, 2019), it is likely that the earliest born pioneer-αβ are increased because of the delayed decrease in the Imp gradient, but that the later-born αβ neurons do not have time to form (see below and Discussion). We note that the total number of neurons labeled by our neuron type specific Gal4 drivers did not add up to the expected number of ~500 neurons in babo mutant clones, which is likely explained by the large variability in the number of γ neurons labeled by γ-Gal4. Next, we focused on understanding whether and how activin signaling interacts with the intrinsic Imp and Syp temporal program.
Activin signaling acts in neuroblasts to lower Imp levels and specify α’β’ neurons
Given that α’β’ neuronal specification is intrinsically controlled by Imp and Syp (Liu et al., 2015), we asked whether activin signaling acts through or in parallel to this intrinsic temporal system, specifically at L3 when α’β’ neurons are being produced. We first asked whether babo is expressed at L3 in mushroom body neuroblasts. Based on published transcriptome data collected from mushroom body neuroblasts at different developmental stages (Liu et al., 2015; Yang et al., 2016), babo is expressed evenly through time in mushroom body neuroblasts, unlike the two RNA binding proteins Imp and Syp (Figure 2—figure supplement 1A). Although this measure does not take into account the possibility of post-transcriptional regulation, it is likely that the activin signaling pathway is temporally controlled by ligand interaction and not by differential expression of babo.
To directly test whether activin signaling acts on Imp and Syp to affect α’β’ specification, we induced MARCM clones for babo at L1 and compared the Imp to Syp protein ratio in mutant mushroom body neuroblasts to surrounding wildtype neuroblasts at wandering L3 (Figure 2). The average Imp to Syp ratio was significantly higher in babo neuroblasts (ratio: 4.2 ± 0.4; n = 9 from 4 different brains) compared to wildtype neuroblasts (ratio: 2.4 ± 0.2; n = 23 from the same 4 brains as babo) at L3, driven by a significantly higher Imp level in mutant neuroblasts (Figure 2, Figure 2—figure supplement 1B) while Syp was not significantly different (Figure 2—figure supplement 1B’). In addition, the α’β’ neuronal marker Mamo (Liu et al., 2019) was lost in babo mutant clones at L3 while the level of Chinmo was higher in these neurons (Figure 2—figure supplement 1C–C’’’), consistent with the notion that high Imp levels block α’β’ specification through maintained higher levels of Chinmo that likely lead to the increased production of γ neurons. The significantly higher Imp to Syp ratio in babo mutant neuroblasts persisted even ~24 hr After Pupal Formation (APF) (babo ratio: 0.58 ± 0.11; n = 7 from 6 different brains; wildtype ratio: 0.27 ±. 02; n = 27 from the same 6 brains as babo), once again driven by higher Imp levels (Figure 2—figure supplement 1D–I). Together, these results indicate that activin signaling lowers Imp levels at late larval and early pupal stages. Importantly, although Imp was higher in babo mutant neuroblasts and persisted longer, the absolute level of Imp still decreased significantly albeit with prolonged kinetics, while the absolute level of Syp was higher in babo mutant neuroblasts at ~24 hr APF vs. L3 (Figure 2—figure supplement 1J–J’): Thus, these changes are either intrinsically regulated or are affected by additional extrinsic factors. Our finding that Imp and Chinmo were higher in babo mutant neuroblasts and neurons at L3 is also consistent with our suggestion that additional γ neurons are produced during the α’β’ time window. The lack of α’β’ neurons in babo mutant clones even though Imp levels were finally low at ~24 hr APF suggests that α’β’ specification may only occur from L3 to the start of pupation.
We have shown that activin signaling functions in mushroom body neuroblasts to decrease Imp during L3. However, previous studies have shown that Babo also acts post-mitotically in mushroom body γ neurons where it times the expression of EcR for their remodeling, indicating that Babo can act independently in neuroblasts and in neurons (Zheng et al., 2003). To test if activin signaling functions post-mitotically in prospective α’β’ neurons, we characterized the morphology of babo mutant neurons born from ganglion mother cell (GMC) clones induced during mid-late L3, the time at which α’β’ neurons are born. GMCs are intermediate progenitors that divide only once to produce two neurons. In this way, the role of Babo in prospective α’β’ neurons can be tested without affecting mushroom body neuroblasts: α’β’ neurons were present in babo GMC clones (n = 34/34), observable by axonal projections into the Trio labeled α’β’ lobes (Figure 2—figure supplement 1K–K’). As a positive control for the efficiency of babo GMC clones, we also made babo GMC clones at L1 to target γ neurons. In the majority of cases, γ axons remained unpruned (n = 8/10, Figure 2—figure supplement 1L–L’; Zheng et al., 2003). These results show that activin signaling acts in mushroom body neuroblasts, and not in neurons, to specify the α’β’ fate.
Activin signaling is sufficient to expand production of α’β’ neurons
Since activin signaling functions in mushroom body neuroblasts and is necessary for α’β’ specification, we next investigated whether it is sufficient for the α’β’ fate. We expressed a constitutively active form of the Babo receptor (UAS-Babo-Act) throughout development in MARCM clones with mb-Gal4 and assessed the total number of α’β’ neurons in the adult by strong Mamo expression. While in wildtype clones the percentage of α’β’ neurons was 25.5 ± 0.7% (n = 7), the number of α’β’ neurons present within UAS-Babo-Act clones significantly increased to 32 ± 1.4% (n = 4) (Figure 3A–B). To ask when these additional α’β’ neurons were produced, we characterized the expression of the α’β’ marker Mamo in young neurons at early L3, when γ neurons are being produced. In comparison to adjacent wildtype neurons, Mamo was expressed in neurons in UAS-Babo-Act clones at this stage (Figure 3C–D). These results confirm the precocious specification of α’β’ neurons, likely at the expense of γ neurons (which would normally be produced at this stage). Importantly, constitutively expressing an activated version of Babo did not result in adult clones consisting entirely of α’β’ neurons, highlighting that activin signaling alone is not master regulator of the α’β’ fate and that other components are necessary to specify this neuronal type.
Glia are the source of the activin ligand Myoglianin to specify α’β’ neurons
Our finding that activin signaling plays an important role in specifying α’β’ identity during mushroom body development led us to question from where the activin ligand originates. Glia secrete the activin ligand Myoglianin (Myo) to initiate γ neuron remodeling by activating EcR at L3 (Awasaki et al., 2011; Yu et al., 2013b). Therefore, we hypothesized that Myo from glia may also regulate α’β’ specification. To test this, we knocked-down myo by expressing UAS-myo-RNAi with repo-Gal4, a driver expressed in all glia, and quantified the total number of α’β’ neurons based on strong Mamo expression in the adult (Figure 4A–E). In comparison to control (428.9 ± 16.2, n = 10), the number of α’β’ neurons was dramatically reduced (106.6 ± 11.4; n = 10) (Figure 4E). Mamo was also not expressed in mushroom body neurons at L3 (Figure 4F–G). Importantly, EcR was not expressed in γ neurons at this stage, providing a positive control for the efficiency of UAS-myo-RNAi (Awasaki et al., 2011). We note that even though the number of α’β’ neurons was reduced in this experiment, myo knockdown was weaker than babo mutant clones, possibly due to incomplete knockdown of myo or because more than one ligand (or more than one source) contribute to α’β’ specification (see Discussion). Our results are consistent with a recent report that also showed that glia are the source of Myo for α’β’ specification (Marchetti and Tavosanis, 2019).
α’β’ neurons are specified by low Imp levels at L3
We and others have shown that activin signaling is necessary for α’β’ specification (Marchetti and Tavosanis, 2019). We have shown that activin signaling acts by lowering Imp levels at L3. Although Imp is required for α’β’ specification (Figure 5—figure supplement 1A–E; Liu et al., 2015), we wanted to determine whether low Imp levels are required at L3. We therefore characterized Mamo expression in young neurons at L3 following knockdown (UAS-Imp-RNAi) or overexpression (UAS-Imp-OE) of Imp with mb-Gal4. (Figure 5A–C; Liu et al., 2015). Consistent with our model, Mamo was not expressed in either condition. In comparison, although knocking-down Syp by expressing UAS-Syp-RNAi led to the loss of Mamo, its early overexpression (UAS-Syp-OE) did not (Figure 5D–E). The loss of Mamo in Syp knockdown is consistent with its role in stabilizing mamo transcripts at L3 (Liu et al., 2019). We conclude that low Imp and low or high Syp levels are required for α’β’ specification. Consistent with this, we were unable to rescue the loss of α’β’ neurons in babo mutant clones by constitutively repressing Imp with UAS-Imp-RNAi (0.2 ± 0.2%, n = 7) (Figure 5—figure supplement 1I, Figure 5—figure supplement 1N, Figure 5—figure supplement 1P), likely due Imp reduction below the threshold required for α’β’ specification (see Discussion). However, we could rescue babo mutant clones by expressing UAS-babo (21.1 ± 2.4%, n = 6) (Figure 5—figure supplement 1F–H, Figure 5—figure supplement 1K–M, Figure 5—figure supplement 1P). Overexpressing Syp (UAS-Syp-OE) to reduce the altered Imp:Syp ratio in babo mutant clones also did not rescue α’β’ neurons (1.8 ± 0.5%, n = 7) (Figure 5—figure supplement 1J, Figure 5—figure supplement 1O–P), further highlighting that Imp but not Syp levels are important for α’β’ specification.
Ecdysone signaling is not necessary for α’β’ specification
It has been proposed that activin signaling in mushroom body neuroblasts leads to EcR expression in neurons and that ecdysone signaling at late L3 induces differentiation of α’β’ neurons (Marchetti and Tavosanis, 2017; Marchetti and Tavosanis, 2019). The role of ecdysone was tested by expressing a dominant-negative ecdysone receptor (UAS-EcR-DN). We confirmed these results by also expressing UAS-EcR-DN driven by mb-Gal4 and were unable to detect GFP+ mutant axons within adult α’β’ lobes marked by Trio (Figure 6A–B). In addition, strong Trio+ and Mamo+ cells were missing inside UAS-EcR-DN mutant clones compared to wildtype clones (wildtype: 25.5 ± 0.7%, n = 7; UAS-EcR-DN: 3.4 ± 0.6%, n = 6) (Figure 6C–E, Figure 6—figure supplement 1A–B). However, we were surprised to find that α’β’ neurons were still present in mutant clones for the EcR co-receptor ultraspiracle (usp) (Figure 6F, Figure 6—figure supplement 1C). Therefore, we sought to better understand how expressing UAS-EcR-DN blocks α’β’ specification.
First, unlike our result in babo mutant neuroblasts, we did not observe a significant difference in the average Imp to Syp protein ratio at L3 in UAS-EcR-DN expressing mushroom body neuroblasts with mb-Gal4 (UAS-EcR-DN ratio: 2.6 ± 0.7, n = 4 from four different brains; wildtype ratio: 1.7 ± 0.3, n = 27 from the same four brains as UAS-EcR-DN) (Figure 6G–J, Figure 6—figure supplement 1D–D’). Driving even stronger expression of UAS-EcR-DN in mushroom body neuroblasts with inscuteable-Gal4 (referred to as NB-Gal4) and labeling all adult neurons with R13F02-Gal4 (referred to as mb2-Gal4) (Jenett et al., 2012) also did not lead to the loss of α’β’ neurons in the adult (Figure 6K–N, Figure 6—figure supplement 1E–F). These results indicate that EcR-DN only blocks α’β’ specification when expressed in newborn mushroom body neurons, not in neuroblasts.
Given these results, we next asked whether expressing UAS-EcR-DN affects Mamo during development, which labels newborn postmitotic α’β’ neurons (Liu et al., 2019); Mamo expression was lost in UAS-EcR-DN expressing clones driven by mb-Gal4 (Figure 6P) but it was not affected by the expression of UAS-EcR-RNAi (Figure 6Q), although the RNAi was effective since we could not detect EcR protein in mushroom body neurons (Figure 6O, Figure 6Q). Given these contradictory results, we compared Mamo and EcR expression at L3. However, Mamo and EcR were mutually exclusive as EcR was not expressed in newborn α’β’ neurons (see Figure 6O’’), which precludes the possibility that EcR-DN inhibits EcR function in these neurons and might therefore act through off-target inhibition of Mamo. These results confirm the lack of EcR protein in mushroom body neuroblasts and young neurons at wandering L3 (Figure 6—figure supplement 1G–H), although EcR was clearly expressed in mature (mostly γ) neurons at this stage (Figure 6—figure supplement 1H–H’’; Lee et al., 2000; Liu et al., 2015; Marchetti and Tavosanis, 2017). Finally, we were unable to rescue the loss of α’β’ neurons in babo mutant clones by expressing UAS-EcR-B1 (Figure 6—figure supplement 1I–J), consistent with the notion that EcR does not function in α’β’ specification downstream of activin signaling (see Discussion). In summary, α’β’ neurons were only lost in adult clones when expressing UAS-EcR-DN (with mb-Gal4) and not in usp mutant clones, and α’β’ neurons were still present when expressing EcR-RNAi in L3. Most importantly, EcR protein was not detected in Mamo+ cells during development, although expressing UAS-EcR-DN blocked Mamo expression at L3. Thus, it is unlikely that ecdysone signaling is involved in α’β’ specification although it might still be used later during α’β’ differentiation (Marchetti and Tavosanis, 2017). We conclude that the loss of α’β’ neurons when expressing UAS-EcR-DN is caused by artifactual inhibition of Mamo (see Discussion).
Discussion
Establishment of mushroom body neuronal identities
Mushroom body neurogenesis is unique and programmed to generate many copies of a few neuronal types. During the early stages of mushroom body development, high Imp levels in mushroom body neuroblasts are inherited by newborn neurons and translated into high Chinmo levels to specify γ identity. As in other central brain neuroblasts, as development proceeds, inhibitory interactions between Imp and Syp help create a slow decrease of Imp and a corresponding increase of Syp. However, at the end of the γ temporal window (mid-L3), activin signaling from glia acts to rapidly reduce Imp levels in mushroom body neuroblasts without significantly affecting Syp, establishing a period of low Imp (and thus low Chinmo in neurons) and also low Syp. This is required for activating effector genes in prospective α’β’ neurons, including Mamo, whose translation is promoted by Syp (Liu et al., 2019). The production of αβ identity begins when Imp is further decreased and Syp levels are high during pupation (modeled in Figure 7). Low Chinmo in αβ neurons is also partly regulated by ecdysone signaling through the activation of Let-7-C, which targets chinmo for degradation (Kucherenko et al., 2012; Wu et al., 2012). Based on our model, α’β’ neurons could not be rescued by knocking-down Imp in babo clones (Figure 5—figure supplement 1I,N,P), since low Imp is required for α’β’ specification while the knockdown reduces its level below this requirement. We might expect to rescue α’β’ neurons if Imp levels were specifically reduced to the appropriate levels at L3. However, reducing Imp levels might not be the only function of activin signaling, which may explain why α’β’ neurons are not simply made earlier (e.g., during L1-L2) when Imp is knocked-down.
In babo mutant clones, we speculate that additional γ neurons are produced at the expense of α’β’ neurons since Imp levels in neuroblasts (as well as Chinmo in neurons) are higher for a longer time during development; There was also a significant decrease in the total number of αβ neurons in babo mutant clones that contrasts with a recent report by Marchetti and Tavosanis that instead concluded that additional pioneer-αβ neurons are produced (Marchetti and Tavosanis, 2019). We believe that there is both an increase in the number of γ neurons and of the pioneer-αβ neuron subclass because pioneer-αβ neurons are the first of the αβ class to be specified (when Imp is still present at very low levels) during pupation. We speculate that pioneer-αβ neurons are produced during the extended low Imp window that we detect during pupation in babo clones. However, this does not leave the time for the remaining population of αβ neurons to be formed, which explains why their number is reduced.
In this study, we have focused on the three main classes of mushroom body neurons although at least seven subtypes exist: 2 γ, 2 α’β’ and 3 αβ (Aso et al., 2014; Shih et al., 2019). The subtypes are specified sequentially (Aso et al., 2014) suggesting that each of the three broad mushroom body temporal windows can be subdivided further, either by fine-scale reading of the changing Imp and Syp gradients, by additional extrinsic cues, or perhaps by a tTF series as in other neuroblasts.
Temporal patterning of Drosophila central brain neuroblasts
Postembryonic central brain neuroblasts are long-lived and divide on average ~50 times. Unlike in other regions of the developing Drosophila brain, rapidly progressing series of tTFs have not yet been described in these neuroblasts (Doe, 2017; Holguera and Desplan, 2018; Kohwi and Doe, 2013; Rossi et al., 2017). Instead, they express Imp and Syp in opposing temporal gradients (Liu et al., 2015; Ren et al., 2017; Syed et al., 2017a). Conceptually, how Imp and Syp gradients translate into different neuronal identities through time has been compared to how morphogen gradients pattern tissues in space (Liu et al., 2019; Liu et al., 2015). During patterning of the anterior-posterior axis of the Drosophila embryo, the anterior gradient of the Bicoid morphogen and the posterior Nanos gradient are converted into discrete spatial domains that define cell fates (Briscoe and Small, 2015; Liu et al., 2019). Since gradients contain unlimited information, differences in Imp and Syp levels through time could translate into different neuronal types. Another intriguing possibility is that tTF series could act downstream of Imp and Syp, similarly to how the gap genes in the Drosophila embryo act downstream of the anterior-posterior morphogens. We have shown that another possibility is that temporal extrinsic cues can be incorporated by individual progenitors to increase neuronal diversity. In mushroom body neuroblasts activin signaling acts directly on the intrinsic program, effectively converting two broad temporal windows into three to help define an additional neuronal type. We propose that subdividing the broad Imp and Syp temporal windows by extrinsic cues may be a simple way to increase neuronal diversity in other central brain neuroblasts.
We have also shown that activin signaling times the Imp to Syp transition for mushroom body neuroblasts, similar to the function of ecdysone for other central brain neuroblasts (Syed et al., 2017a). In both cases however, the switch still occurs, indicating that a separate independent clock continues to tick. This role for extrinsic cues during Drosophila neurogenesis is reminiscent of their roles on individual vertebrate progenitors. For example, hindbrain neural stem cells progressively produce motor neurons followed by serotonergic neurons before switching to producing glia (Chleilat et al., 2018; Dias et al., 2014). The motor neuron to serotonergic neuron switch is fine-tuned by TGFβ signaling. It would be interesting to determine if hindbrain neuronal subtypes are lost in TGFβ mutants, similar to how α’β’ identity is lost in the mushroom bodies in babo mutants.
Ecdysone signaling is not necessary for α’β’ specification
The specification of α’β’ neurons begins at mid-L3 with the onset of Mamo expression (Liu et al., 2019). In contrast, high levels of EcR are detected in mature mushroom body neurons starting at late L3 (Lee et al., 2000). At this stage, both γ and α’β’ neurons already exist and new α’β’ neurons are still being generated. Thus, Mamo expression precedes EcR expression. These non-overlapping expression patterns suggest that ecdysone signaling does not regulate Mamo and therefore cannot control the specification of α’β’ neurons. Furthermore, expression of UAS-EcR-RNAi or mutants for usp do not lead to the loss of α’β’ neurons. We note that our usp results contradict the loss of α’β’ neuron reported by Marchetti and Tavosanis, 2017 in usp clones. However, we could see α’β’ neurons in these clones based on the morphology of these neurons but the remodeling defect of γ neurons makes α’β’ neurons difficult to identify. Nevertheless, ecdysone might still function later during α’β’ differentiation, particularly during pupation when all mushroom body neurons express EcR.
We and Marchetti and Tavosanis have both shown that expression of UAS-EcR-DN leads to the loss of α’β’ neurons by acting in mushroom body neurons but not in neuroblasts (Marchetti and Tavosanis, 2017). However, EcR must be first be expressed in the target cells of interest in order to make any conclusions about ecdysone function using UAS-EcR-DN. Since we cannot detect EcR protein in Mamo+ cells at L3, but expressing UAS-EcR-DN inhibits Mamo in those cells, we conclude that EcR-DN artifactually represses Mamo and leads to the loss of α’β’ neurons. This explains why expressing UAS-EcR-B1 does not rescue α’β’ neurons in babo clones. However, Marchetti and Tavosanis did rescue babo-RNAi by expressing EcR (Marchetti and Tavosanis, 2019). This is likely because our experiments were performed using babo MARCM clones in which the loss of α’β’ neurons is much more severe than with babo-RNAi used in their experiments (Figure 1—figure supplement 1Q; Marchetti and Tavosanis, 2019). Indeed, when we attempted to eliminate α’β’ neurons using a validated UAS-babo-RNAi construct (Awasaki et al., 2011), γ neurons did not remodel but there was only a minor (but significant) decrease in the number of α’β’ neurons. This indicates that knocking-down babo with mb-Gal4 that is only weakly expressed in neuroblasts and newborn neurons is not strong enough to inhibit α’β’ specification. Thus, we speculate that the LexA line used by Marchetti and Tavosanis (GMR26E01-LexA) may not be a reliable reporter for α’β’ neurons upon babo knockdown, and that it might be ecdysone sensitive later in α’β’ differentiation. Since EcR expression in all mushroom body neurons at L3 may be dependent on activin signaling directly in neurons, as it is in γ neurons for remodeling (Zheng et al., 2003), expressing UAS-EcR-B1 together with UAS-babo-RNAi using OK107-Gal4 might both reduce the effectiveness of the RNAi while also allowing for the re-expression of GMR26E01-LexA.
Glia are a source of the activin ligand myo, which is temporally expressed in brain glia starting at L3 to initiate the remodeling of mushroom body γ neurons (Awasaki et al., 2011) and α’β’ specification (Figure 4; Marchetti and Tavosanis, 2019). However, knocking-down Myo from glia is not as severe as removing Babo from mushroom body neuroblasts. This might be due to incomplete knockdown of myo or to other sources of Myo, potentially from neurons. For example, in the vertebrate cortex, old neurons signal back to young neurons to control their numbers (Parthasarathy et al., 2014; Seuntjens et al., 2009; Toma et al., 2014; Wang et al., 2016). It is also possible the Babo is activated by other activin ligands, including Activin and Dawdle (Upadhyay et al., 2017). An intriguing hypothesis is that the temporal expression of myo in glia beginning at mid-L3 is induced by the attainment of critical weight and rising ecdysone levels. It would be interesting to determine whether blocking ecdysone signaling in glia leads to the loss of α’β’ specification, similar to how blocking ecdysone reception in astrocytes prevents γ neuron remodeling (Hakim et al., 2014).
Conserved mechanisms of temporal patterning
It is well established that extrinsic cues play important roles during vertebrate neurogenesis, either by regulating temporal competence of neural stem cells or by controlling the timing of temporal identity transitions (reviewed in Kawaguchi, 2019). Competence changes mediated by extrinsic cues were demonstrated in classic heterochronic transplantation studies that showed that young donor progenitors produce old neuronal types when placed in older host brains (Desai and McConnell, 2000; Frantz and McConnell, 1996; McConnell, 1988). Recent studies show that the reverse is also true when old progenitors are placed in a young environment (Oberst et al., 2019).
Mechanisms of intrinsic temporal patterning are also conserved (Alsiö et al., 2013; Elliott et al., 2008; Holguera and Desplan, 2018; Konstantinides et al., 2015; Mattar et al., 2015; Shen et al., 2006). For example, vertebrate retinal progenitor cells use an intrinsic tTF cascade to bias young, middle, and old retinal fates (Elliott et al., 2008; Liu et al., 2020; Mattar et al., 2015). Two of the factors (Ikaros and Casz1) used for intrinsic temporal patterning are orthologs to the Drosophila tTFs Hb and Cas. tTF series might also exist in cortical radial glia progenitors and even in the spinal cord (Delile et al., 2019; Gao et al., 2014; Llorca et al., 2019; Telley et al., 2016; Telley et al., 2019). Recent results also show the importance of post-transcriptional regulation in defining either young or old cortical fates (Shu et al., 2019; Zahr et al., 2018), which can be compared to the use of post-transcriptional regulators that are a hallmark of neuronal temporal patterning in Drosophila central brain neuroblasts. These studies highlight that the mechanisms driving the diversification of neuronal types are conserved.
Materials and methods
Drosophila strains and MARCM
Request a detailed protocolFlies were kept on standard cornmeal medium at 25°C. For MARCM experiments, embryos were collected every 12 hr. After 24 hr, L1 larvae were placed at 37°C for 2 hr for neuroblast clones or 15 min for GMC clones. To target GMCs at L3, larvae were aged for 84 hr and then placed at 37°C for 15 min. Brains were dissected from 1 to 5 day old adults.
We used the following transgenic and mutant flies in combination or recombined in this study. {} enclose individual genotypes, separated by commas. Stock numbers refers to BDSC unless otherwise stated:
{y, w, UAS-mCD8::GFP, hsFlp; FRTG13, tub-Gal80/CYO;; OK107-Gal4 (gift from Oren Schuldiner)}, {hsFLP, y, w; FRTG13, UAS-mCD8::GFP (#5131)}, {hsFLP, tubP-GAL80, w, FRT19A; UAS-mCD8::GFP/CyO; OK107-Gal4 (#44407)}, {hsFLP, y, w, UAS-mCD8::GFP; FRT82B, tubP-GAL80/TM3, Sb1; OK107-Gal4 (#44408)}, {hsFLP, y1, w*, UAS-mCD8::GFP; tubP-GAL80, FRT40A; OK107-Gal4 (#44406)}, {UAS-EcR.B1-DeltaC655.W650A (#6872)}, {y, w, FRT19A (#1744)}, {FRTG13, babo52 (gift from Dr. Michael B. O’Connor)}, {w; FRTG13 (#1956)}, {w1118; repo-Gal4/TM3, Sb1 (#7415)}, {w; GMR71G10-GAL4 (#39604)}, {w; GMR41C07-GAL4/TM3, Sb1 (#48145)}, {w; GMR13F02-GAL4 (#48571)}, {w; GMR44E04-GAL4 (#50210)}, {w*; insc-Gal4Mz1407 (#8751)}, {usp2/FM7a (#31414)}, {Met27, gce2.5K/FM7c, 2xTb1-RFP, sn+ (gift from Dr. Lynn Riddiford)}, {yd2, w1118, ey-FLP; taiEY11718 FRT40A/CyO, y+ (DGRC #114680)}, {dpyov1, tai61G1, FRT40A/CyO (#6379)}, {w*; smo119B6, al1, dpyov1, b1, FRT40A/CyO (#24772)}, {FRT82B, svp1/TM3 (gift from Tzumin Lee)}, {y1, w*, UAS-mCD8::GFP, SmoxMB388, FRT19A/FM7c (#44384)}, {w*;; UAS-p35 (#5073)}, {y1, w; Mi{PT-GFSTF.1}EcR[MI05320-GFSTF.1]/SM6a, (#59823)}, {y1, w*; PinYt/CyO; UAS-mCD8::GFP (#5130)}, {w*;; UAS-EcR.B1 (#6469)}, {y, w;; UAS-babo-a/TM6 (gift from Dr. Michael O’Connor)}, {UAS-Imp-RNAi (#34977)}, {UAS-Imp-RM-Flag (gift from Dr. Tzumin Lee)}, {UAS-Syp-RNAi (VDRC 33012, gift from Dr. Tzumin Lee)}, {UAS-Syp-RB-HA (gift from Dr. Tzumin Lee)}, {y1, v1; UAS-myoglianin-RNAi (#31200)}, {w*; OK107-Gal4/In4, ciD (#854)}; {w, UAS-EcR-RNAi (#9326)}; {w, UAS-EcR-RNAi (#9327)}; {yw, UAS-babo.Q302D (#64293)}; {UAS-babo-RNAi (#44400)}.
Immunohistochemistry and microscopy
Request a detailed protocolFly brains were dissected in ice-cold PBS and fixed for 15–20 min in 4% Formaldehyde (v/w) in 1XPBS. Following a 2 hr wash in PBST (1XPBS + 0.3% Triton X-100), brains were incubated for 1–2 days in primary antibodies diluted in PBST, followed by overnight with secondary antibodies diluted in PBST. After washes, brains were mounted in Slowfade (Life Technologies) and imaged on either a Leica SP5 or SP8 confocal. Images were processed in Fiji and Adobe Illustrator (CC18).
We used the following antibodies in this study: sheep anti-GFP (1:500, Bio-Rad #4745–1051; RRID:AB_619712), mouse anti-Trio (1:50, DSHB #9.4A anti-Trio; RRID:AB_528494), guinea pig anti-Mamo (1:200, this study, Genscript), mouse anti-FasII (1:50, DSHB #1D4 anti-Fasciclin II; RRID:AB_528235), rat anti-Imp (1:200, this study, Genscript), rabbit anti-Syp (1:200, this study, Genscript), guinea pig anti-Dpn (1:1000, Genscript), rabbit anti-FasII (1:50, this study, Genscript), mouse anti-EcR-B1 (1:20, DSHB #AD4.4(EcR-B1); RRID:AB_528215), mouse anti-Dac2-3 (1:20, DSHB #mAbdac2-3; RRID:AB_528190), guinea pig anti-Chinmo (1:200, this study, Genscript), rat anti-Chinmo (1:200, gift from Dr. Cedric Maurange), rat anti-DNcad (1:20, DSHB #DN-Ex #8; RRID:AB_528121), donkey anti-sheep Alexa 488 (1:500, Jackson ImmunoResearch #713-545-147; RRID:AB_2340745), donkey anti-mouse Alexa 555 (1:400, Thermo Scientific #A-31570; RRID:AB_2536180), donkey anti-rabbit Alexa 555 (1:400, Thermo Scientific #A-31572; RRID:AB_162543), donkey anti-rat Alexa 647 (1:400, Jackson Immunochemicals #712-605-153; RRID:AB_2340694), donkey anti-guinea pig Alexa 647 (1:400, Jackson Immunochemicals #706-605-148; RRID:AB_2340476), donkey anti-rabbit 405 (1:100, Jackson Immunochemicals #711-475-152; RRID:AB_2340616), donkey anti-rat Cy3 (1:400, Jackson Immunochemicals #712-165-153; RRID:AB_2340667), donkey anti-mouse 405 (1:100, Jackson Immunochemicals #715-475-150; RRID:AB_2340839).
Polyclonal antibodies were generated by Genscript (https://www.genscript.com/). The epitopes used for each immunization are listed below.
Mamo: amino acids 467–636 of the full length protein:
MDDRLEQDVDEEDLDDDVVVVGPATAMARGIAQRLAHQNLQRLHHTHHHAQHQHSQHHHPHSQHHHTPHHQQHHTHSDDEDAMPVIAKSEILDDDYDDEMDLEDDDEADNSSNDLGLNMKMGSGGAGGGGGVDLSTGSTLIPSPLITLPSSSAAAAAAAAAAMESQRSTPHHHHHH.
Imp: amino acids 76–455 (of isoform PB) of the full length protein:
ADFPLRILVQSEMVGAIIGRQGSTIRTITQQSRARVDVHRKENVGSLEKSITIYGNPENCTNACKRILEVMQQEAISTNKGEICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKITVSSINDINSFNLERIITVKGLIENMSRAENQISTKLRQSYENDLQAMAPQSLMFPGLHPMAMMSTPGNGMVFNTSMPFPSCQSFAMSKTPASVVPPVFPNDLQETTYLYIPNNAVGAIIGTRGSHIRSIMRFSNASLKIAPLDADKPLDQQTERKVTIVGTPEGQWKAQYMIFEKMREEGFMCGTDDVRLTVELLVASSQVGRIIGKGGQNVRELQRVTGSVIKLPEHALAPPSGGDEETPVHIIGLFYSVQSAQRRIRAMML.
Syp: amino acids 35-231(of isoform PA) of the full length protein:
MAEGNGELLDDINQKADDRGDGERTEDYPKLLEYGLDKKVAGKLDEIYKTGKLAHAELDERALDALKEFPVDGALNVLGQFLESNLEHVSNKSAYLCGVMKTYRQKSRASQQGVAAPATVKGPDEDKIKKILERTGYTLDVTTGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMM.
FasII: amino acids 770–873 (of isoform PA) of the full length protein:
MHHHHHHDLLCCITVHMGVMATMCRKAKRSPSEIDDEAKLGSGQLVKEPPPSPLPLPPPVKLGGSPMSTPLDEKEPLRTPTGSIKQNSTIEFDGRFVHSRSGEIIGKNSAV.
Chinmo: amino acids 494–604 (of isoform PF) of the full length protein:
MLNVWNATKMNNKNSVNTADGKKLKCLYCDRLYGYETNLRAHIRQRHQGIRVPCPFCERTFTRNNTVRRHIAREHKQEIGLAAGATIAPAHLAAAAAASAAATAAAS NHSPHHHHHH.
Cell counts quantification
Request a detailed protocolAll confocal images were taken with a step size of three microns. Using Fiji, each image was cropped to limit the area to a region containing mostly mushroom body cell bodies. In all cases, GFP+ cells were manually counted. To count α’β’ neurons, images were split into their individual channels and the channel containing Mamo staining was automatically binarized to account for weak and strong Mamo expression using either Default or RenyiEntropy thresholding. Binarized images were processed further using the Watershed method to differentiate between contacting cells. The number of particles (i.e., strong Mamo cells) measuring between 50-infinity squared pixels were automatically counted using the Analyze Particles function and a separate channel containing bare outlines of the counts was produced and inverted. This method automatically produced the total number of strong Mamo+ cells. Individual channels were then remerged. Outlines drawn from the Analyze Particles function that overlapped with GFP+ cells were defined as α’β’ neurons within a clone. In the eight cases where two mushroom body neuroblasts were labeled in a single hemisphere (wildtype:1; babo, UAS-EcR: 3; babo, UAS-Syp: 2), the total number of α’β’ neurons within clones was divided by 2.
Imp and Syp fluorescence quantification
Request a detailed protocolAll brains used for quantifying Imp and Syp fluorescence values in babo or UAS-EcR-DN mutants were prepared together. Additionally, all images used for quantification were imaged using the same confocal settings for each channel. Fluorescence measurements were made in Fiji. Values for Imp and Syp were measured within the same hand-drawn area encompassing the entire neuroblast from a single z-slice.
Statistics
Statistical tests were performed in Excel or R. The exact tests used are reported in the figure legends. In all cases, whisker plots represent the minimum value (bottom whisker), first quartile (bottom of box to middle line), inclusive median (middle line), third quartile (middle line to top of box) and maximum value (top whisker). The ‘x’ represents the average value. Outliers are 1.5 times the distance from the first and third quartile. Reported are averages ± standard error of mean (SEM).
Data availability
All data generated or analysed during this study are included in the manuscript and supporting files.
-
NCBI Gene Expression OmnibusID GSE71103. Opposite Imp/Syp temporal gradients govern birth time-dependent neuronal fates.
References
-
Glia instruct developmental neuronal remodeling through TGF-β signalingNature Neuroscience 14:821–823.https://doi.org/10.1038/nn.2833
-
Intrinsically different retinal progenitor cells produce specific types of progenyNature Reviews Neuroscience 15:615–627.https://doi.org/10.1038/nrn3767
-
Do the right thing: neural network mechanisms of memory formation, expression and update in DrosophilaCurrent Opinion in Neurobiology 49:51–58.https://doi.org/10.1016/j.conb.2017.12.002
-
Tripartite mushroom body architecture revealed by antigenic markersLearning & Memory 5:38–51.
-
Progressive restriction in fate potential by neural progenitors during cerebral cortical developmentDevelopment 127:2863–2872.
-
Temporal patterning in the Drosophila CNSAnnual Review of Cell and Developmental Biology 33:219–240.https://doi.org/10.1146/annurev-cellbio-111315-125210
-
What can tiny mushrooms in fruit flies tell Us about learning and memory?Neuroscience Research 129:8–16.https://doi.org/10.1016/j.neures.2017.05.002
-
The Drosophila mushroom body is a quadruple structure of clonal units each of which contains a virtually identical set of neurones and glial cellsDevelopment 124:761–771.
-
Temporal fate specification and neural progenitor competence during developmentNature Reviews Neuroscience 14:823–838.https://doi.org/10.1038/nrn3618
-
Development of the Drosophila mushroom bodies: sequential generation of three distinct types of neurons from a neuroblastDevelopment 126:4065–4076.
-
Generating neuronal diversity in the mammalian cerebral cortexAnnual Review of Cell and Developmental Biology 31:699–720.https://doi.org/10.1146/annurev-cellbio-100814-125353
-
Fates of visual cortical neurons in the ferret after isochronic and heterochronic transplantationThe Journal of Neuroscience 8:945–974.https://doi.org/10.1523/JNEUROSCI.08-03-00945.1988
-
Timing temporal transitions during brain developmentCurrent Opinion in Neurobiology 42:84–92.https://doi.org/10.1016/j.conb.2016.11.010
-
Nuclear Transcriptomes of the Seven Neuronal Cell Types That Constitute the Drosophila Mushroom BodiesG3: Genes, Genomes, Genetics 9:81–94.https://doi.org/10.1534/g3.118.200726
-
Regulating neural proliferation in the Drosophila CNSCurrent Opinion in Neurobiology 20:50–57.https://doi.org/10.1016/j.conb.2009.12.005
-
Olfactory representations by Drosophila mushroom body neuronsJournal of Neurophysiology 99:734–746.https://doi.org/10.1152/jn.01283.2007
-
TGF-β family signaling inDrosophila cold spring harbPerspect. Biol 9:a022152.https://doi.org/10.1101/cshperspect.a022152
-
Molecular architecture of smell and taste in DrosophilaAnnual Review of Neuroscience 30:505–533.https://doi.org/10.1146/annurev.neuro.30.051606.094306
-
Ecdysone control of developmental transitions: lessons from Drosophila researchAnnual Review of Entomology 58:497–516.https://doi.org/10.1146/annurev-ento-120811-153608
-
Clonal development and organization of the Adult Drosophila Central BrainCurrent Biology : CB 23:633–643.https://doi.org/10.1016/j.cub.2013.02.057
Article and author information
Author details
Funding
National Eye Institute (R01 EY017916)
- Claude Desplan
National Institute of Neurological Disorders and Stroke (R21 NS095288)
- Claude Desplan
National Institutes of Health (T32 HD007520)
- Anthony M Rossi
New York University (GSAS MacCracken Program)
- Anthony M Rossi
New York State Stem Cell Science (DOH01-C32604GG)
- Claude Desplan
The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.
Acknowledgements
We would like to thank the fly community, the Bloomington and the DGRC stock centers for flies and reagents; Nikos Konstantinides for discussion throughout the project and comments on the manuscript, and the three reviewers for constructive feedback on our paper; Tzumin Lee for sharing data prior to publication and for discussions; Tzumin Lee, Lynn Riddiford, Oren Schuldine, Cedric Maurange and Michael B O’Connor for fly stocks and antibodies; And all the Desplan lab members for their discussion and comments on the manuscript. Funding: This work was supported by grants from NIH (R01 EY017916 and R21 NS095288) and from NYSTEM (DOH01-C32604GG) to CD. AMR was partly supported by funding from NIH (T32 HD007520), and by NYU’s GSAS MacCracken Program and a Dean’s Dissertation Fellowship.
Copyright
© 2020, Rossi and Desplan
This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.
Metrics
-
- 2,235
- views
-
- 340
- downloads
-
- 28
- citations
Views, downloads and citations are aggregated across all versions of this paper published by eLife.
Download links
Downloads (link to download the article as PDF)
Open citations (links to open the citations from this article in various online reference manager services)
Cite this article (links to download the citations from this article in formats compatible with various reference manager tools)
Further reading
-
- Developmental Biology
- Genetics and Genomics
The establishment and growth of the arterial endothelium requires the coordinated expression of numerous genes. However, regulation of this process is not yet fully understood. Here, we combined in silico analysis with transgenic mice and zebrafish models to characterize arterial-specific enhancers associated with eight key arterial identity genes (Acvrl1/Alk1, Cxcr4, Cxcl12, Efnb2, Gja4/Cx37, Gja5/Cx40, Nrp1 and Unc5b). Next, to elucidate the regulatory pathways upstream of arterial gene transcription, we investigated the transcription factors binding each arterial enhancer compared to a similar assessment of non-arterial endothelial enhancers. These results found that binding of SOXF and ETS factors was a common occurrence at both arterial and pan-endothelial enhancers, suggesting neither are sufficient to direct arterial specificity. Conversely, FOX motifs independent of ETS motifs were over-represented at arterial enhancers. Further, MEF2 and RBPJ binding was enriched but not ubiquitous at arterial enhancers, potentially linked to specific patterns of behaviour within the arterial endothelium. Lastly, there was no shared or arterial-specific signature for WNT-associated TCF/LEF, TGFβ/BMP-associated SMAD1/5 and SMAD2/3, shear stress-associated KLF4 or venous-enriched NR2F2. This cohort of well characterized and in vivo-verified enhancers can now provide a platform for future studies into the interaction of different transcriptional and signalling pathways with arterial gene expression.
-
- Developmental Biology
- Genetics and Genomics
Paternal obesity has been implicated in adult-onset metabolic disease in offspring. However, the molecular mechanisms driving these paternal effects and the developmental processes involved remain poorly understood. One underexplored possibility is the role of paternally induced effects on placenta development and function. To address this, we investigated paternal high-fat diet-induced obesity in relation to sperm histone H3 lysine 4 tri-methylation signatures, the placenta transcriptome, and cellular composition. C57BL6/J male mice were fed either a control or high-fat diet for 10 weeks beginning at 6 weeks of age. Males were timed-mated with control-fed C57BL6/J females to generate pregnancies, followed by collection of sperm, and placentas at embryonic day (E)14.5. Chromatin immunoprecipitation targeting histone H3 lysine 4 tri-methylation (H3K4me3) followed by sequencing (ChIP-seq) was performed on sperm to define obesity-associated changes in enrichment. Paternal obesity corresponded with altered sperm H3K4me3 at promoters of genes involved in metabolism and development. Notably, altered sperm H3K4me3 was also localized at placental enhancers. Bulk RNA-sequencing on placentas revealed paternal obesity-associated sex-specific changes in expression of genes involved in hypoxic processes such as angiogenesis, nutrient transport, and imprinted genes, with a subset of de-regulated genes showing changes in H3K4me3 in sperm at corresponding promoters. Paternal obesity was also linked to impaired placenta development; specifically, a deconvolution analysis revealed altered trophoblast cell lineage specification. These findings implicate paternal obesity effects on placenta development and function as one potential developmental route to offspring metabolic disease.