1. Cell Biology
  2. Structural Biology and Molecular Biophysics
Download icon

The heteromeric PC-1/PC-2 polycystin complex is activated by the PC-1 N-terminus

  1. Kotdaji Ha
  2. Mai Nobuhara
  3. Qinzhe Wang
  4. Rebecca V Walker
  5. Feng Qian
  6. Christoph Schartner
  7. Erhu Cao
  8. Markus Delling  Is a corresponding author
  1. Department of Physiology, University of California, San Francisco, United States
  2. Department of Biochemistry, University of Utah School of Medicine, United States
  3. Division of Nephrology, Department of Medicine, University of Maryland School of Medicine, United States
Research Article
  • Cited 2
  • Views 1,262
  • Annotations
Cite this article as: eLife 2020;9:e60684 doi: 10.7554/eLife.60684


Mutations in the polycystin proteins, PC-1 and PC-2, result in autosomal dominant polycystic kidney disease (ADPKD) and ultimately renal failure. PC-1 and PC-2 enrich on primary cilia, where they are thought to form a heteromeric ion channel complex. However, a functional understanding of the putative PC-1/PC-2 polycystin complex is lacking due to technical hurdles in reliably measuring its activity. Here we successfully reconstitute the PC-1/PC-2 complex in the plasma membrane of mammalian cells and show that it functions as an outwardly rectifying channel. Using both reconstituted and ciliary polycystin channels, we further show that a soluble fragment generated from the N-terminal extracellular domain of PC-1 functions as an intrinsic agonist that is necessary and sufficient for channel activation. We thus propose that autoproteolytic cleavage of the N-terminus of PC-1, a hotspot for ADPKD mutations, produces a soluble ligand in vivo. These findings establish a mechanistic framework for understanding the role of PC-1/PC-2 heteromers in ADPKD and suggest new therapeutic strategies that would expand upon the limited symptomatic treatments currently available for this progressive, terminal disease.

eLife digest

On the surface of most animal and other eukaryotic cells are small rod-like protrusions known as primary cilia. Each cilium is encased by a specialized membrane which is enriched in protein complexes that help the cell sense its local environment. Some of these complexes help transport ions in out of the cell, while others act as receptors that receive chemical signals called ligands. A unique ion channel known as the polycystin complex is able to perform both of these roles as it contains a receptor called PC-1 in addition to an ion channel called PC-2.

Various mutations in the genes that code for PC-1 and PC-2 can result in autosomal dominant polycystic kidney disease (ADPKD), which is the most common monogenetic disease in humans. However, due to the small size of primary cilia – which are less than a thousandth of a millimeter thick – little is known about how polycystin complexes are regulated and how mutations lead to ADPKD. To overcome this barrier, Ha et al. modified kidney cells grown in the lab so that PC-1 and PC-2 form a working channel in the plasma membrane which surrounds the entire cell. As the body of a cell is around 10,000 times bigger than the cilium, this allowed the movement of ions across the polycystin complex to be studied using conventional techniques.

Experiments using this newly developed assay revealed that a region at one of the ends of the PC-1 protein, named the C-type lectin domain, is essential for stimulating polycystin complexes. Ha et al. found that this domain of PC-1 is able to cut itself from the protein complex. Further experiments showed that when fragments of PC-1, which contain the C-type lectin domain, are no longer bound to the membrane, they can activate the polycystin channels in cilia as well as the plasma membrane. This suggests that this region of PC-1 may also act as a secreted ligand that can activate other polycystin channels.

Some of the genetic mutations that cause ADPKD likely disrupt the activity of the polycystin complex and reduce its ability to transport ions across the cilia membrane. Therefore, the cell assay created in this study could be used to screen for small molecules that can restore the activity of these ion channels in patients with ADPKD.


The most common monogenetic disease in humans is ADPKD; a major nephropathy characterized by renal cysts that leads to urinary tract infection, hypertension, aneurysm, and ultimately end-stage renal disease (ESRD) (Kathem et al., 2014; Harris and Torres, 2009). Mutations in one of two ciliary proteins, PC-1 (encoded by PKD1) and PC-2 (also known as TRPP1 and encoded by PKD2), account for 85% and 15% of ADPKD-causing mutations, respectively (Harris and Torres, 2009; Cornec-Le Gall et al., 2014).

PC-1 is an 11 transmembrane (TM) protein of 4303 amino acids with a long extracellular N-terminus that contains multiple cell adhesion domains (Yoder et al., 2002; Hughes et al., 1995). PC-1 and its family members (PC-1L1, PC-1L2, and PC-1L3) share the same 11-TM topology but vary in the size and adhesion domain composition of their N-termini (Ishimaru et al., 2006). A unique feature of PC-1 family members, shared only by adhesion G protein-coupled receptors (GPCRs), is the GPCR autoproteolysis inducing (GAIN) domain. This domain catalyzes peptide bond hydrolysis at a GPCR proteolysis site (GPS) that is positioned proximal to the first TM helix (TM1) (Araç et al., 2012; Prömel et al., 2013; Trudel et al., 2016). Autoproteolysis generates two fragments: an N-terminal fragment (NTF) and a multi-TM core (Qian et al., 2002). The NTF contains multiple domains, including leucine-rich repeats, a C-type lectin (CTL) domain, immunoglobulin (Ig)-like polycystic kidney disease (PKD) repeat domains, a single low-density lipoprotein (LDL) receptor motif, and the receptor for egg jelly (REJ) domain (Hughes et al., 1995; Babich et al., 2004; Moy et al., 1996). The function of the multi-TM core remains poorly defined. Autoproteolysis occurs early in the ER secretory pathway such that the N- terminal fragment remains non-covalently tethered (Lin et al., 2004; Wei et al., 2007). While mutations within the GPS site of PC-1 result in renal cyst formation, the full functional consequences of autoproteolysis are poorly understood (Qian et al., 2002; Yu et al., 2007).

Recent studies suggest that PC-1 and PC-2 form a 1:3 heteromer (Su et al., 2018; Yu et al., 2009). Indeed, the cryo-EM structure of a PC-1/PC-2 heteromer reveals that the 11 transmembrane helices of PC-1 are further divided into two major domains: a peripheral TM1-TM5 complex and a core TM6-TM11 complex that interdigitates with three PC-2 subunits to form a TRP-like ion channel (Su et al., 2018). In addition to this PC-1/PC-2 assembly, PC-2 can form homomeric channels, following a classic homotetramer of TRP channels (Shen et al., 2016; Grieben et al., 2017; Wilkes et al., 2017).

Attempts to exogenously express and record from PC-1 and/or PC-2 in whole cell recordings of mammalian cells (Hanaoka et al., 2000; Delmas et al., 2004; Cai et al., 2004) and reconstituted lipid bilayers González-Perrett et al., 2001 have yielded divergent results, likely due to subcellular enrichment of PC-1 and PC-2 (for a detailed discussion see Liu et al., 2018; Kleene and Kleene, 2017). In addition, despite recent advances in measuring ion channel activity in small subcellular organelles such as the cilium (Kleene and Kleene, 2012; DeCaen et al., 2013; Dong et al., 2008), it remains technically challenging to study ion channel activity in primary cilia due to their small size (10−15 L, approximately the size of a bacterium). This technical hurdle has hindered investigations of the physiological regulation of polycystins and how they lead to renal disease when mutated. The unknown role of PC-1 within the channel complex, in particular, has hindered progress in the field. Some studies suggest that PC-1 acts as a dominant-negative subunit of the heteromeric channel (Su et al., 2018), whereas others suggest that it is a pore-forming subunit that fine-tunes ion selectivity (Wang et al., 2019). Moreover, PC-1 has been shown to be dispensable for polycystin currents in ciliary membranes (Liu et al., 2018). Here we develop cellular assays that allow us to probe the function of polycystin complexes in the plasma membrane and compare them to polycystin channels in their native primary cilia. Our heterologous system recapitulates the biophysical properties of cilia-localized polycystin channels and demonstrates how distinct PC-1 family members contribute to ion permeation. Importantly, we reveal that the N-terminal domain of PC-1 functions as a soluble ligand and is an indispensable activator of the polycystin complex, providing further evidence for chemosensory regulation of the polycystin complex (Delling et al., 2016).


PC-1 and PC-2 form functional channels in the plasma membrane

Because robust assays to investigate the heteromeric polycystin complex are lacking, we developed an assay system to determine the contribution of PC-1 family members to polycystin function. We were able to target PC-1 to the plasma membrane of HEK293 cells (Figure 1B) and mIMCD3 cells (Figure 1—figure supplement 1E) by replacing its endogenous signal peptide with a strong Ig κ-chain secretion sequence followed by an HA tag (sPC-1; Figure 1A, Table 1; Salehi-Najafabadi et al., 2017; Zhu et al., 2011). The HA tag allowed us to quantify sPC-1 plasma membrane expression by measuring surface staining following addition of anti-HA antibodies to non-permeabilized cells. Co-expression of sPC-1 and PC-2 resulted in strong HA surface staining, whereas expression of sPC-1 alone resulted in only marginal surface staining, in both HEK293 cells (Figure 1B and C) and IMCD3 cells (Figure 1—figure supplement 1D and E). Co-expression of PC-2 and PC-1 with an extracellular HA tag but without the endogenous leader sequence (HAPC-1) failed to generate comparable HA surface staining, supporting the notion that an Ig κ-secretion sequence promotes membrane localization of the complex (Figure 1B). To test whether PC-2 facilitates sPC-1 membrane localization by promoting ER exit or by co-migration to the plasma membrane, we inserted a FLAG epitope into the extracellular tetragonal opening for polycystins (TOP) domain of PC-2 (PC-2FLAG) (Figure 1—figure supplement 1A, Table 1). Robust surface HA and FLAG staining only occurred when both sPC-1 and PC-2FLAG were co-expressed, suggesting that they are shuttled simultaneously to the plasma membrane (Figure 1—figure supplement 1B and C). Similarly, co-expression of sPC-1 with PC-2 containing a recently in an oocyte expression system characterized gain of function mutation of PC-2 (PC-2F604P, Table 1; Arif Pavel et al., 2016) resulted in comparable HA surface expression (Figure 1B and C).

Figure 1 with 1 supplement see all
PC-1 and PC-2 form functional channels in the plasma membrane.

(A) Illustration of PC-1 and PC-2F604P topology highlighting extracellular HA and secretion sequence (indicated with an s prefix) in PC-1. (B) Expression and immunostaining of HEK293 cells transfected with sPC-1/PC-2, HAPC-1/PC-2 with endogenous leader sequence, sPC-1/PC-2F604P, and sPC-1 alone. Left column, representative images of HA surface staining (see methods). Middle column, total staining for PC-2 or PC-1. Right column, merged images. Scale bar: 10 μm. (C) Quantification of relative anti-HA surface staining shown in B. ***: p<0.0001. (D) Representative currents from each construct recorded in the whole cell patch clamp configuration in response to voltage step pulses (left). (E) Whole-cell I-V relationship of sPC-1/PC-2F604P (n = 6, red) and PC-1/PC-2F604P (n = 10, white). Arrow indicates the expanded view of I-V relationship between membrane potentials of −50 mV and +50 mV. (F) Current densities for sPC-1/PC-2F604P, HAPC-1/PC-2F604P, sPC-1/PC-2, and PC-2F604P alone at +100 mV. (G) Relative open probability of sPC-1/PC-2F604P at −80 mV calculated using a Boltzmann distribution fitted to I/Imin of tail current amplitudes, black line (n = 6, red). (H) Top view of the human PC-1/PC-2 polycystin complex using pymol (Su et al., 2018). Positively charged R4100, R4107, and H4111 are highlighted in red and displayed in stick shape (top). Side view of selectivity filter showing the location of three positively charged amino acids on PC-1 TM-11 (bottom). (I) Representative whole cell currents of sPC-1pore/PC-2F604P. (J) I-V relationship of sPC-1/PC-2F604P (n = 6, red) and sPC-1pore/PC-2F604P (n = 6, blue). Arrow indicates the expanded view of I-V relationship between −50 mV and +50 mV. Current densities of sPC-1/PC-2F604P and sPC-1pore/PC-2F604P were compared at +100 mV holding potential. (K) Relative open probability analysis of sPC-1/PC-2F604P (n = 6, red) and sPC-1pore/PC-2F604P (n = 6, blue) during a −80 mV tail pulse. Statistical significance is indicated by the background. ***p<0.001 (dark gray), **p<0.01 (gray), *p<0.05 (light gray). Statistical analysis was computed using student t-test unpaired one-pair.

Table 1
Constructs used in this study.
Construct nameProtein tagMutation
sPC-1/PC-2F604Pκ-IgG signal peptide and HA tag at 5’ end of PC-1F604P in PC-2
PC-1/PC-2F604PHA tag at 5’ end of PC-1F604P in PC-2
sPC-1/PC-2κ-IgG signal peptide and HA tag at 5’ end of PC-1wild type PC-2
sPC-1/PC-2FLAGκ-IgG signal peptide and HA tag at 5’ end of PC-1, FLAG insertion in PC-2 TOP domain (pos. 904):…PSNGT-DYKDDDK-SFIFY…
PC-2F604P-F604P in PC-2
sPC-1pore/PC-2F604Pκ-IgG signal peptide and HA tag at 5’ end of PC-1R4100G, R4107G, H4111G in PC-1 F604P in PC-2
PC-1ΔNT/PC-2HA tag (P2Y12)Substitution of PC-1 N-terminus adjacent to TM-1 (position 9184) with P2Y12 N-terminus. (HA_P2Y12_mypydvpdyaqavdnltsapgntslctrdykitq)-(vrfvfp…_PC-1)
PC-1ΔNT/PC-2F604PHA tag (P2Y12)Substitution of PC-1 N-terminus with P2Y12 N-terminus F604P in PC-2
sPC-1L3/PC-2κ-IgG signal peptide and HA tag at 5’ end of mPC-1L3-
sPC-1L31NT/PC-2κ-IgG signal peptide and HA tag at 5’ end of PC-1 N-terminusSubstitution of mPC-1L3 N-terminus with hPC-1 N-terminus at GPS cleavage (hPC-1…CLTR-HLTFFSS…mPC-1L3)
sPC-11L3NT/PC-2κ-IgG signal peptide and HA tag at 5’ end of PC-1L3 N-terminusSubstitution of hPC-1 N-terminus with 1-1052aa of mPC-1L3 at GPS cleavage (mPC-1L3…QCLCD-HLTAFGA…hPC-1)
sPC-11L3CTL/PC-2F604Pκ-IgG signal peptide and HA tag at 5’ end of PC-1Replacement of PC-1 C-type lectin domain (407-547aa) with C-type lectin domain of PC-1L3 (30-150aa)
sPC-1L31CTL/PC-2F604Pκ-IgG signal peptide and HA tag at 5’ end of PC-1L3Replacement of PC-1L3 C-type lectin domain (30-138aa) with C-type lectin domain of PC-1 (415-535aa)
sPC-1/PC-2F604PN375Qκ-IgG signal peptide and HA tag at 5’ end of PC-1 N-terminusF604P in PC-2, N375Q in PC-2

Having established robust plasma membrane expression of sPC-1/PC-2 and sPC-1/PC-2F604P, we asked whether these proteins form functional channels using whole cell patch clamp recordings. Interestingly, only sPC-1/PC-2F604P produced constitutively active, outward rectifying currents (122.6 ± 23.0 pA/pF at +100 mV, n = 7) with a half-maximal activation voltage of +112.5 mV (Figure 1D, E and G). sPC-1/PC-2 (5.1 ± 1.0 pA/pF, n = 11), HAPC-1/PC-2F604P (5.0 ± 2.3 pA/pF, n = 15) and PC-2F604P alone (6.4 ± 2.1 pA/pF, n = 12) yielded negligible currents at +100 mV (Figure 1F). To investigate the functional contribution of PC-1 to heteromeric polycystin complexes, we mutated three positively charged amino acids in the putative ion permeation pathway to the small, uncharged amino acid glycine (R4100G, R4107G, and H4111G) in order to facilitate cation permeation (sPC-1pore; Figure 1H, Table 1). In combination with PC-2F604P, currents of 71.1 ± 5.4 pA/pF (n = 6) were generated at +180 mV (sPC-1pore/PC-2F604P; Figure 1I). Although the recorded current density was ~50 pA/pF smaller than for sPC-1/PC-2F604P (Figure 1J), the relative open probability at −100 mV was higher (0.3 ± 0.0 for sPC-1pore/PC-2F604P; 0.1 ± 0.0 for sPC-1/PC-2F604P), suggesting that the pore mutant resides in a more open state (Figure 1K).

Collectively, these results demonstrate that PC-1/PC-2 subunits form a functional channel when reconstituted in mammalian cells and support the notion that PC-1 subunits form part of the core channel complex.

The PC-1 N-terminus is essential for polycystin complex activation

We sought to determine whether PC-1 subunits are involved in the regulation of the polycystin complex by investigating the functional role of the N-terminal domain. We reasoned that the N-terminus must be a critical determinant of polycystin function because ADPKD-causing mutations occur with high frequency in this region and therefore investigated a family member with a divergent N-terminus, PC-1L3 (Figure 2A and Figure 2—figure supplement 1A). Substitution of PC-1L3’s signal peptide with the κ IgG secretion sequence (sPC-1L3, Table 1) resulted in strong surface HA staining when co-expressed with PC-2 or PC-2F604P (Figure 2B and D). However, we were unable to record convincing currents in sPC-1L3/PC-2F604P-transfected HEK cells (3.5 ± 0.0 pA/pF, n = 12), suggesting that, although present in the plasma membrane, the complex is inactive (Figure 2C). To determine the structural domains in PC-1 subunits that are required for channel activation, we generated chimeras between PC-1 and PC-1L3: the N-terminus of PC-1 fused to the 11-TM core of PC-1L3 preceding the GPS cleavage site (sPC-1L31NT) and the opposing arrangement (sPC-11L3NT) (Figure 2A, Table 1). We also substituted the entire PC-1 N-terminus with the 26 amino acid-long N-terminus of the P2Y12 receptor and an extracellular HA tag (PC-1ΔNT, Table 1); a modification known to increase surface expression of GPCRs without impairing functionality (Liberles and Buck, 2006; Liebscher et al., 2015).

Figure 2 with 1 supplement see all
The PC-1 N-terminus is essential for polycystin complex activation.

(A) Schematic diagram illustrating topology of PC-1 (blue) and PC-1L3 (yellow), including PC-1ΔNT (top), PC-1 N-terminal chimeras (top), and PC-1L3 N-terminal chimeras (bottom). (B) Immunostaining of HEK293 cells transfected with indicated chimera. Left, representative images of anti-HA surface staining. Middle, total staining for PC-2. Right, merged images. Scale bar: 10 μm. (C) Representative whole cell current traces of each construct obtained from the voltage step pulses shown in Figure 1D. (D) Quantification of anti-HA surface staining of each construct shown in (B). ***p<0.001. (E) I-V relationships for N-terminal chimeras sPC-1L31NT/PC-2F604P (n = 5, purple), sPC-11L3CTL/PC-2F604P (n = 10, light blue) and sPC-1L3/PC-2F604P (n = 12, orange). (F) Relative open probabilities for sPC-1L31NT/PC-2F604P (n = 5, purple) and sPC-1/PC-2F604P (n = 6, red, dataset from Figure 1E) obtained during tail pulses at −80 mV. Statistical significance is indicated by the background. ***p<0.001 (dark gray), **p<0.01 (gray), *p<0.05 (light gray). Statistical analysis was computed using student t-test unpaired one-pair. (G) I-V relationships for sPC-1/PC-2F604P (n = 6, red), sPC-1L31CTL/PC-2F604P (n = 5, green), and sPC-1L3/PC-2F604P (n = 12, black).

All chimeras localized to the plasma membrane when co-expressed with PC-2F604P (Figure 2B and D). PC-1ΔNT resulted in the strongest surface staining, likely due to the smaller size of this protein. Of the three chimeras, only sPC-1L31NT/PC-2F604P generated small but appreciable outward currents (35.9 ± 12.9 pA/pF, n = 5). Currents in cells expressing sPC-11L3NT/PC-2F604P (9.1 ± 1.9 pA/pF, n = 10) and PC-1ΔNT/PC-2F604P (7.6 ± 1.5 pA/pF, n = 10) were negligible (Figure 2C and E). Furthermore, the relative open probability of the sPC-1L31NT/PC-2F604P chimera at −100 mV (0.44 ± 0.0) was ~four-fold higher than sPC-1/PC-2F604P (0.1 ± 0.0) and similar to that for sPC-1pore/PC-2F604P (0.3 ± 0.0) (Figure 2F). Interestingly, the predicted ion permeation region of PC-1L3 does not contain the positively charged amino acids found in PC-1, offering a possible explanation for the greater open probability observed in the sPC-1L31NT/PC-2F604P chimeras (Figure 2—figure supplement 1A). In terms of channel regulation, these results support the hypothesis that the N-terminus of PC-1 is a key determinant of polycystin complex activation.

Polycystin activation depends on CTL and TOP domains

To gain a more detailed understanding of the role played by the N-terminus in polycystin complex activation, we replaced smaller regions of the PC-1L3 N-terminus with those from PC-1. One chimera replaced the 108 AA CTL domain of PC-1L3 with the CTL of PC-1 (sPC-1L31CTL; Figure 2A, Table 1). sPC-1L31CTL/PC-2F604P generated robust outward currents (87.5 ± 9.0 pA/pF, n = 5) (Figure 2C and G) whereas the inverse chimera (sPC-11L3CTL) produced only minimal currents (9.1 ± 1.9 pA/pF, n = 10). These data strongly suggest that the PC-1 CTL domain is essential to activate the polycystin complex.

In mammalian cells, the PC-1 ectodomain undergoes at least one proteolytic cleavage event at the GPS site, suggesting that the N-terminus might be liberated as a secreted ligand. Indeed, it has been reported that PC-1 N-terminus-containing exosomes interact with primary cilia in kidney nephrons (Hogan et al., 2009). We therefore investigated whether fragments of the PC-1 N-terminus can regulate the polycystin complex. We purified various PC-1 NTFs from HEK cell supernatant (Figure 2—figure supplement 1C–1E) and tested their ability to confer channel activity on PC-1ΔNT/PC-2F604P heteromers when included in the bath solution. Surprisingly, application of an NTF spanning the distal region AA 24–852 (NTF24-852), including the CTL domain between PKD I and II (amino acids 415–531; Figure 2—figure supplement 1B and C), conferred the ability to carry outward currents on PC-1ΔNT/PC-2F604P heteromers (65.5 ± 37.2 pA/pF, n = 6) (Figure 3A and C). Similarly, a shorter NTF containing the CTL domain (NTF263-535; Figure 2—figure supplement 1B and C) was also able to induce outward currents (61.4 ± 10.5 pA/pF, n = 4; Figures 3A, B and C). In both cases, the currents were smaller than those for sPC-1/PC-2F604P (Figure 1F). Boiling NTF263-535 at 95°C for 10 min rendered it inactive (Figure 3B). Next, we perfused HEK cells overexpressing PC-1ΔNT/PC-2F604P heteromers with NTF263-535 and measured acute changes in current density. While PC-1ΔNT/PC-2F604P channels remained inactive in the absence of NTF263-535, acute application increased current density by 765.1 ± 185.05% (from 5.9 ± 1.3 pA/pF to 59.1 ± 19.3 pA/pF, n = 7) within 10 s of application (Figures 3D, F and G). However, non-transfected cells did not respond to NTF263-535 under comparable condition (4.6 ± 1.6 pA/pF to 6.8 ± 1.4 pA/pF, n = 9) (Figure 3E and G). We then asked whether the removal of PC-1 N-terminus inactivates the polycystin heteromer. To test this possibility, we perfused sPC-1/PC-2F604P overexpressing HEK cells with 0.125% trypsin, assuming that proteolytic digestion of extracellular proteins also removes critical regions within the PC-1 N-terminus. As shown in Figure 3H perfusion with 0.125% trypsin decreased sPC-1/PC-2F604P dependent currents by 78.4 ± 4.9% (from 52.0 ± 17.1 pA/pF to 8.9 ± 1.4 pA/pF, n = 6, Figure 3H and J, and K). By contrast, untransfected cells did not respond to 0.125% trypsin (7.2 ± 1.9 pA/pF versus 4.6 ± 0.8 pA/pF, n = 5). Taken together, these data suggest that the N-terminus including the CTL of PC-1 is necessary and sufficient to activate the polycystin complex.

Polycystin activation depends on the C-Type lectin domain.

(A) Representative whole cell currents of PC-1ΔNT/PC-2F604P after application of PC-1 NTF24-852 (left) or NTF263-535 (right). (B) I-V relationships of PC-1ΔNT/PC-2F604P with addition of NTF263-535 (n = 6, pink), PC-1ΔNT/PC-2F604P with addition of heat-inactivated fragment (n = 8, black), and PC1ΔNT/PC-2F604P alone (n = 8, green). (C) Current densities of untransfected cells (gray) and PC-1ΔNT/PC-2F604P after addition of control medium (n = 7, white), NTF24-852 (n = 5, blue) and NTF263-535, (n = 6, pink). ***, p<0.001. (D) Time course of PC-1ΔNT/PC-2F604P transfected cells in response to NTF263-535. Currents are recorded at +180 mV (black) and −100 mV (red). Orange bar indicates addition of NTF. (E) Time course of untransfected cells in response to NTF263-535. Conditions are identical to D. (F) I-V relationships obtained by voltage ramp pulse for PC-1ΔNT/PC-2F604P before (black) or after (red) NTF263-535 application. (G) Current densities at +100 mV potential from PC-1ΔNT/PC-2F604P (n = 7) or untransfected cells (n = 9) before (blank) or after application (red) of NTF263-535. (H) Time course of sPC-1/PC-2F604P transfected cells in response to application of 0.125% trypsin. Currents are recorded at +180 mV (black) and −100 mV (red). Orange bar indicates addition of trypsin. (J) I-V relationships for sPC-1/PC-2F604P before (black) and after (red) 0.125% trypsin application. (K) Current densities at +100 mV potential from for sPC-1/PC-2F604P (n = 6) and untransfected cells (n = 5) before (blank) or after (red) 0.125% trypsin application.

Next, we asked how the extracellular CTL domain in PC-1 might regulate activation of the entire channel complex. We reasoned that the TOP domain in PC-2 is well positioned to function as a surface receptor as it forms a bridge between the pore domain and voltage sensor-like domain, and is critical for channel activation (Shen et al., 2016; Vien et al., 2020). In addition, different glycosylation patterns of the TOP domain might underlie conformational changes in the homomeric PC-2 complex (Wilkes et al., 2017). We observed prominent glycosylation of the TOP domain in PC-2 at position N375, N362, and N328 (Figure 4A). Moreover, although mutation of N375 to glutamine did not affect surface localization of sPC-1/PC-2F604PN375Q (Figure 4B and C), it rendered the channel inactive (Figure 4D and E). Thus, glycosylation of the TOP domain in PC-2 appears to be required for CTL-dependent polycystin activation.

C-type lectin binds to the TOP domain of PC-2.

(A) Location of carbohydrates (yellow mesh) bound to N375 in the TOP domain of the PC-2 channel (protein data bank ID: 5T4D). Right, expanded view of carbohydrate binding to N375 site. (B) Quantification of anti-HA surface staining of sPC-1/PC-2F604P and sPC-1/PC-2F604PN375Q compared to untransfected cells. ***p<0.001. (C) Immunostaining of HEK293 cells transfected with sPC-1/PC-2F604PN375Q. Scale bar: 10 μm. (D) Representative whole cell current traces of sPC-1/PC-2F604PN375Q. (E) I-V relationships for sPC-1/PC-2F604PN375Q (n = 11, orange) and sPC-1/PC-2F604P (n = 6, red, dataset from Figure 1E).

N-terminal PC-1 fragments activate ciliary polycystin complexes

Although the results so far strongly suggest that the PC-1 CTL domain is critical for activating heterologous polycystin complexes, native polycystin complexes reside in the specialized membranes of primary cilia (Liu et al., 2018; Kleene and Kleene, 2017; Vien et al., 2020). We, therefore, investigated whether the PC-1 N-terminus is able to activate polycystin complexes in the cilia of polarized mouse epithelial (mIMCD-3) cells using excised ciliary membrane patch clamp recordings (Figure 5—figure supplement 1B). Without any NTFs, we readily detected single channel openings at potentials more positive than +60 mV and more negative than −80 mV (Figure 5A) in 7 out of 38 cilia. After ablating PC-1 expression in mIMCD3 cells using CRISPR/CAS9 (Figure 5—figure supplement 1A) ciliary channels remained readily detectable in 4 of 13 cilia (Figure 5B), in agreement with previous reports (Liu et al., 2018). In addition, single channel conductance was comparable between wt mIMCD3 (γ = 79.5 ± 0.1 pS) and PC-1 knockout cilia (γ = 82.3 ± 0.0 pS) (Figure 5—figure supplements 1G, H, 2A and B). However, we noted that the open probability of channels at negative membrane potentials in PC-1 knock out primary cilia (0.58 ± 0.01) was higher than in wt IMCD3 cilia (0.08 ± 0.01) (Figure 5G). These data suggest that PC-2 forms a homomeric complex in the absence of PC-1 subunits with a higher open probability than that of PC-1/PC-2 heteromers. The results also support the idea that PC-1 subunits impede cation flux across the membrane, in agreement with our PC-1 pore mutant data (Figure 1I–K). Ablation of PC-2 expression using CRISPR/CAS9 rendered primary cilia electrically silent (n = 11), confirming that PC-2 subunits are an essential component of polycystin channels (Figure 5C; Liu et al., 2018; Kleene and Kleene, 2017).

Figure 5 with 2 supplements see all
An N-terminal PC-1 fragment activates ciliary polycystin complexes.

(A, B, C) Excised ciliary inside-out patch clamp recordings of channels from mIMCD-3 cells (left), PC-1 knockout mIMCD-3 cells (middle), and PC-2 knockout mIMCD-3 cells (right). (D) Single channel patch clamp recordings at −100 mV in cell attached configuration for sPC-1/PC-2F604P (top) and excised inside-out ciliary patches for mIMCD-3, mIMCD-3 with addition of NTF263-535 in pipette solution, and PC-1 knockout cells (rows 2–4, respectively). (E) Open time histogram of channel openings at −100 mV holding potential. (F) Time constants of open time distributions in E obtained using one decay equation, *p<0.05 (n = 7/38 for mIMCD-3 cilia, n = 4/13 for PC-1 KO, n = 4/23 for mIMCD-3 cilia + NTF263-535, and n = 6 for sPC-1/PC-2F604P). (G) Absolute open probabilities for recordings shown in A, B, and C, **p<0.01.

To test whether NTFs can activate the native polycystin complex, we recorded single channels in inside out patches pulled from primary cilia in the presence of 0.7 μg/mL (equal to ~50 nM final concentration) of NTF263-535 in the recording pipette. Although the percentage of electrically active cilia (n = 4/13) remained largely unaffected, NTF263-535 increased the probability of single channels openings by ~five-fold and significantly prolonged the duration of channel openings at negative membrane potentials (Figure 5E–G).

Collectively, these findings demonstrate that PC-2 subunits are essential for functional polycystin channels in primary cilia, that PC-1 subunits also participate in the native heteromeric complex, and that NTF263-535 can activate this complex under physiological conditions.

NTF263-535 activates Ca2+ influx into primary cilia

Having established that NTF263-535 can activate ciliary polycystin channels, we asked whether it could also trigger Ca2+ entry through the channel. We initially attempted single channel recordings from mIMCD-3 wt cilia under conditions in which Ca2+ is the sole charge carrier (see Materials and methods). We were unable to measure currents, even at very negative membrane potentials (−140 mV) (Figure 6A), in agreement with previously published results (Liu et al., 2018). Surprisingly, however, the application of NTF263-535 revealed channel openings close to physiological membrane potentials (Figure 6B). Single channel conductance was smaller when using Ca2+ instead of Na+ and K+ as the charge carrier (47.5 pS, Figure 6C). Voltage-dependent open probability and open time remained unchanged (Figure 6D and E).

NTF263-535 activates Ca2+ influx into primary cilia.

(A) Excised inside-out patch single channel recordings of mIMCD-3 cilia with 2 mM CaCl2 and 10 mM HEPES in pipette solution at membrane potentials between −60 mV and −120 mV. (B) Excised inside-out patch single channel recordings from mIMCD-3 cilia with 0.7 µg/mL of NTF263-535 in the pipette. Membrane potentials held between −60 mV and −120 mV. (C) I-V relationship obtained from ciliary excised patch clamp recordings from mIMCD-3 cilia with NTF263-535 (n = 3/16). Red line indicates linear fitting. (D) Absolute open probabilities obtained at membrane potentials between −60 mV and −120 mV (n = 3/16). (E) Open time histogram of channel opening events after NTF263-535 application at −100 and 120 mV. Small bar graph indicates time constants obtained from one decay fits of the histogram (n = 3/16). (F) Representative TIRF images after addition of 50 nM NTF263-535 to mIMCD-3 cells stably expressing Arl13B-scarlet-GCaMP6. GCaMP images are pseudo-colored based on pixel intensity. Scale bar: 5 µm. (G) Representative traces of changes in fluorescence (ΔF/F) during TIRFM imaging. Image acquisition every 250 ms. (H) Quantification of maximum peak area of fluorescence (ΔF/F*s) for control, PC-2 knock out cells + NTF263-535, wt mIMCD3 cilia + boiled NTF263-535, and wt mIMCD3 cilia + NTF263-535. (I) Quantification of number of calcium spikes observed in TIRFM imaging for control, PC-2 knock out cells + NTF263-535, wt mIMCD3 cilia + boiled NTF263-535, and wt mIMCD3 cilia + NTF263-535. Quantification is from three independent experiments, **p<0.01.

We subsequently tested whether NTF263-535 can also induce changes in ciliary Ca2+ concentration ([Ca2+]cilium) using an improvement to our recently-published ciliary ratiometric Ca2+ sensors (Delling et al., 2016; Delling et al., 2013). We fused mScarlet and GCaMP6s to Arl13b (Arl13b-sca-G6) and stably expressed the construct in both wt and PC-2 knockout mIMCD-3 cells. Cells growing on the bottom side of transwell inserts were imaged using TIRF microscopy (TIRFM) to detect localized changes in [Ca2+]cilium (Ishikawa and Marshall, 2015). Application of NTF263-535 generated multiple rapid spike-like elevations of [Ca2+]cilium (ΔF/F > 0.35, n = 35 cilia) whereas untreated cells (n = 22) and cells treated with boiled NTF263-535 (n = 28) did not exhibit such fluctuations (Figure 6F and G). In addition, NTF263-535 did not elicit [Ca2+]cilium fluctuations in PC-2 knockout cells (n = 15; Figure 6H and I). These results show that polycystin channels conduct Ca2+ when activated by NTF263-535.


We have demonstrated that PC-1 and related family members form a functional ion channel with PC-2. These heteromeric complexes exhibit distinct biophysical properties, suggesting that PC-1 members are critical for adjusting the electrical excitability of primary cilia in response to the local environment. By expressing membrane-targeted PC-1 or PC-1L3 with PC-2 in mammalian cells, we show that the PC-1 N-terminus is essential for the activation of complexes containing PC-2 subunits, including those carrying the gain of function mutation F604P. More specifically, we show that the CTL domain within the N-terminus of PC-1 is essential for channel activation and that it might function by interacting with the TOP domain of PC-2. In cilia, we provide evidence that an N-terminal fragment containing the CTL domain is sufficient to activate endogenous Ca2+-permeable polycystin channels and elevate [Ca2+]cilium. Thus, we suggest a novel autoregulation mechanism in which the N-terminus of PC-1 activates the channel it is attached to or channels on adjacent cilia following cleavage to become a soluble ligand.

The PC-1 ectodomain is critical for polycystin complex activation

Our data identify PC-1’s CTL domain as an essential component for polycystin activation. Interestingly, the CTL domain is a hotspot for ADPKD-causing mutations (Dong et al., 2019), supporting the critical importance of this domain (Figure 2—figure supplement 1B). Although C-type lectins are the most diverse family of mammalian carbohydrate-binding proteins (Keller and Rademacher, 2020), little is known about the function of the CTL motif within PC-1 (Sandford et al., 1997), but it has been reported to bind to carbohydrates in a calcium-dependent manner (Weston et al., 2001). All PC-1 family members except PC-1L1 contain an N-terminal CTL, yet PC-1L3 CTL fails to activate the complex. Because the CTL amino acid sequence diverges between different PC-1s, we speculate that each binds to different carbohydrates. It is worth noting that other domains within the N-terminus are also implied in cell-cell recognition, including leucine-rich repeats (LRRs), cell wall integrity and stress response component (WSC), and REJ domain. Future studies addressing the specificity and mechanism of CTL binding, especially to carbohydrate moieties, will be of interest.

Both PC-1 and PC-2 have a large extracellular TOP domain, which contains prominent glycosylation sites. We speculate that the CTL domain in the native PC-1/PC-2 complex interacts with glycans in the TOP domain, which allosterically regulates the ion permeation pathway and/or gating apparatus of the heteromeric polycystin channel (Vien et al., 2020; Figure 7). In particular, the N-glycan attached to N375 of PC-2 is adjacent to a structure that extends above TM3 and TM4 of the voltage sensor-like domain, so it is conceivable that binding of the CTL domain to this glycan will initiate conformational changes in the voltage sensor-like domain, which could be transmitted to the pore to regulate ion permeation. Indeed, ablation of this glycan by mutation (N375Q) results in a complex that can traffic to the plasma membrane but that remains inactive.

Graphical abstract PC-1 N-terminus with its C-type lectin domain interacts with carbohydrates in the PC-2 TOP domain and activates the channel complex in the cilium.

PC-1 N-terminus may either activate the channel as a soluble ligand or remain tethered to the channel complex and undergo intermolecular binding to TOP domains on neighboring channels. Channel activity can be different in the presence of N-terminal fragments of PC-1.

Plasma membrane-targeted polycystins recapitulate biophysical features of ciliary currents

Signal peptides are cleaved from the nascent polypeptide early in the biosynthetic pathway, thus sPC-1, which is ectopically targeted to the plasma membrane, closely resembles wt PC-1 (Salehi-Najafabadi et al., 2017). Likewise, the effective membrane targeting sequence found in the N-terminus of P2Y12 has been successfully used to target adhesion GPCRs to the plasma membrane without compromising functionality (Liebscher et al., 2015). The PC-2 F604P mutant has recently been characterized as a gain of function mutant in a Xenopus oocyte overexpression model (Arif Pavel et al., 2016). It is thought that the F604P substitution within S5 induces conformational changes in the S4-S5 linker (Zheng et al., 2018) that lock PC-2 in an open state. Indeed, proline substitutions in the S5 segment of several other TRP family members result in constitutive channel activity (Grimm et al., 2007; Xu et al., 2007; Zhou et al., 2017). A careful comparison of our ciliary recordings of endogenous polycystin channels with membrane-targeted polycystins reveals that both channel populations exhibit comparable biophysical characteristics, lending weight to the effectiveness of our plasma membrane expression system for studying polycystins.

Our results are in agreement with previous reports of channel activity in the ciliary membrane of renal epithelial cells (Liu et al., 2018; Kleene and Kleene, 2017; DeCaen et al., 2013; Flannery et al., 2015). Because no measurable electrical activity remains in mIMCD-3 cells following CRISPR ablation of PC-2, we confirm that the PC-2 subunit is an indispensable component of ciliary currents in kidney epithelial cells (Liu et al., 2018; Kleene and Kleene, 2017). We also find that primary cilia of mIMCD-3 cells still contain functional channels after CRISPR ablation of PC-1. We speculate that currents recorded from PC-1 knockout cilia are due to homotetrameric PC-2 channels, although we cannot exclude a contribution from other PC-2-containing heteromeric channels such as PC-1L1/PC-2, PC-1L3/PC-2, or PC-2/TRPM3 (Field et al., 2011; DeCaen et al., 2013; Flannery et al., 2015; Bai et al., 2008; Kleene et al., 2019Zhang et al., 2013). We noted two striking differences between channels in wt and PC-1 knockout mIMCD-3 cilia at voltages close to the resting membrane potential (DeCaen et al., 2013). First, the native PC-1/PC-2 heteromeric channel in wt cilia showed very short channel openings compared to the presumably homotetrameric PC-2 channel, supporting the hypothesis raised by cryo-EM data that PC-1 reduces ion flux (Su et al., 2018). Second, wt IMCD-3 cilia were electrically silent between membrane potentials of −60 mV and +40 mV whereas channels in PC-1 knockout cilia opened at −40 mV.

The PC-1 N-terminus likely underlies the molecular mechanism of chemosensation

In our experiments, soluble fragments containing the CTL motif not only restore channel function in polycystin complexes lacking the PC-1 N-terminus but also lengthen the open time duration of endogenous polycystins at negative membrane potentials. This strongly suggests that the PC-1 N-terminus is an agonist for polycystin activation. Our results provide the first insights into why ADPKD-causing mutations are enriched within both CTL and GAIN domains, the latter of which is critical for proteolytic processing and subsequent shedding of the CTL-containing ectodomain. Our results show that soluble fragments of PC-1 potentiate endogenous polycystin channels that already contain one PC-1 N-terminus. Given the predicted three PC-2:1 PC-1 stoichiometry of the heteromeric polycystin complex, we hypothesize that possibly all three PC-2 TOP domains need to be simultaneously engaged by CTL domains in order to trigger a concerted conformational change in their respective voltage sensor-like domains and therefore full channel activation. Alternatively, the tethered PC-1 N-terminus in a native heteromeric polycystin complex may be sterically constrained to participate in intramolecular interactions with its core complex, and thus might engage in intermolecular interactions, either between polycystin complexes on one cilium or as a cilia-cilia proximity sensor.

Alternatively, as-yet-unknown proteins and/or small molecule ligands can bind to modules (such as LRRs) that are in proximity to or in the CTL domain itself. This might mask the carbohydrate-binding site on the CTL domain and thus add another layer of regulation to the polycystin complex. While our results show that CTL is required for channel activation, we cannot exclude the possibility that other more potent agonists of the polycystin complex exist. Future work will determine how the PC-1 N-terminus functions as a polycystin agonist in vivo, either as a soluble ligand or bound to vesicles such as exosomes. We speculate that transport of such ligands by fluids may underline the molecular chemosensory mechanism of primary cilia.

Our data reveal that activation of endogenous polycystins by N-terminal fragments of PC-1 increases ciliary [Ca2+] in ~30% of cilia imaged. This is in agreement with previously published work in which only a fraction of cilia shows electrically active polycystin channels. It remains to be determined whether and how agonistic ciliary second messengers, which may only be stochastically present during ciliary recordings, add another layer of regulation to ciliary polycystin channels. Alternatively, there may be an as-yet-unidentified inhibitory signal in cilia that prevents activation of the polycystin complex in some ciliary recordings.

Materials and methods

Key resources table
Reagent type
(species) or
DesignationSource or
Gene (Homo sapiens)hPKD1GenBankL33243
Gene (Homo sapiens)hPKD2GenBankNM_000297
Gene (Mus musculus)mPKD1-L3GenBankNM_001286454
Gene (Homo sapiens)hArl13bGenBankNM_182896
Cell line (Mus musculus)mIMCD3ATCCCRL-2123
Cell line (Mus musculus)mIMCD3 PC-1 koThis paperDerived from CRL-2123CRISPR-CAS9 ablated PC-1 expression
Cell line (Mus musculus)mIMCD3 PC-2 koFrom Dr Steven Kleene, University of Cincinnati
Derived from CRL-2123CRISPR-CAS9 ablated PC-2 expression
Cell line (Homo-sapiens)HEK293ATCCCRL-1573
Antibody (mouse)Anti-FLAG (M2)Sigma AldrichF3165-1MG(1:100)
Antibody (rabbit)Anti-Acetylated tubulin (K40)Cell signalling5335 s(1:10.000)
Antibody (mouse)Anti-PC-2 (YCE2)Santa CruzYCE2
Anti-PC-1 (E8)Baltimore PKD centerE8(1 µg/mL western blot)
Recombinant DNA reagentpTRE3G-BiTakara BioCat # 631337
Recombinant proteinPC-1 NTF 24–852This paperAmplified from L33243
Recombinant proteinPC-1 NTF 263–535This paperAmplified from L33243
Software, algorithmPRISM10Graphpad
Software, algorithmpCLAMPMolecular Devices
Software, algorithmClampfit10.6Molecular Devices
OtherHöchst 33342Thermo Fisher1:10.000

Molecular biology

Request a detailed protocol

hArl13B-EGFP was described previously. Arl13b-scarlet-GCaMP6s is an updated version of our previously characterized ciliary Ca2+ sensor Arl13b-mCherry-GECO1.2 in which mcherry and GECO1.2 have been replaced with mScarlet and GCaMP6s, respectively. κ IgG HA-PC-1L3 (sPC-1L3) has been described previously (Salehi-Najafabadi et al., 2017). sPC-1 was generated by using a unique BglII site within hPKD1 to replace the endogenous signal peptide with the 12 aa k IgG leader sequence followed by HA tag using PCR amplification and Gibson assembly (NEB). HAPC-1 was generated by inserting an HA tag between the predicted endogenous signal peptide and mature polypeptide chain following the same protocol. For the construction of FLAG-PC-2, several positions within the extracellular domains of PC-2 with negatively charged amino acids were tested. We identified one region at position 372 that tolerated the insertion of the FLAG sequence, based on surface trafficking. Chimera constructs of PC-1 and PC-1L3 were generated by substituting the ectodomain at the GPS cleavage site with the corresponding orthologue using PCR and Gibson assembly. All PC-1 and PC-2 combinations were cloned into pTRE3G-Bi vector (Takara Bio). The MCSI site was used for PC-1 variants while the MCSII site was used for PC-2 variants. This ensured simultaneous translation of PC-1 and PC-2 from the same plasmid. All DNA sequences were confirmed by sequencing (ELIM Bio).


Rabbit anti-acetylated tubulin (K40)(D20G3) Cell Signaling Technology (5335 s); rat anti-hemaglutinin (HA), Roche (11867423001); mouse anti-FLAG M2, Sigma-Aldrich (F3165-1MG); rat anti PC1 antibody (E8) (Baltimore PKD core center); mouse anti PC2 (YCE2) antibody, Santa Cruz Biotechnology (SC-47734).

Immunocytochemistry and confocal microscopy

Request a detailed protocol

Cells were fixed with 4% formaldehyde, permeabilized with 0.2% Triton X-100, and blocked by 2% FBS, 2% BSA, and 0.2% fish gelatin in PBS. Cells were labeled with the indicated antibody and secondary goat anti-rabbit, anti-rat or anti-mouse fluorescently labeled IgG (Thermo Fisher) and Hoechst 33342 (Thermo Fisher). Confocal images were obtained using a Nikon spinning disk with a 63× oil immersion, 1.2 N.A. objective, or a 100× oil immersion, 1.4 N.A. objective at the UCSF Nikon Imaging Core. Images were further processed using ImageJ (NIH).

Cell culture and quantification of plasma membrane PC-1 and PC-2

Request a detailed protocol

Tet inducible mIMCD3 and HEK293 cells were generated from parental lines (obtained from ATCC) according to the manufacture’s protocol (Takara Bio). HEK or IMCD3 cells expressing the tet activator were transiently co-transfected with the indicated pTRE3G-Bi vector (Takara Bio) and the EGFP vector using Lipofectamine LTX for mIMCD3 or Lipofectamine2000 for HEK293 (Thermo Fisher). Surface trafficking of PC-1 and PC-2 was measured by quantifying the amount of anti-HA or anti-FLAG antibody bound to the plasma membrane, respectively. 24 hr after transfection 1 ug/mL doxycycline was added and cells were incubated for an additional 24 hr. For surface staining, adherent live cells were incubated with opti-MEM containing either anti-HA antibody (1:100) or anti-FLAG antibody (1:100) for 20 min at room temperature to avoid internalization of antibodies. Cells were washed twice with opti-MEM and fixed with 4% PFA. After incubation with blocking buffer, cells were labeled with secondary goat anti-rat or goat anti-mouse antibodies conjugated to Alexa 647. Several Z stacks of indicated groups were acquired using identical settings and 647 fluorescence was quantified on all GFP positive cells using ImageJ. This approach allowed an unbiased quantification of membrane inserted HA. In addition, expression of the proteins was confirmed in total staining using permeabilized cells. mIMCD3 cells with ablated PC-2 expression were described previously (Kleene and Kleene, 2017). Cells were tested for mycoplasma contamination regularly (Lonza). Data are representative of at least three independent experiments.


Request a detailed protocol

Recordings were performed using a multiclamp 200B (Axon Instruments), digitized using a digidata 1324A (Axon Instruments) and recorded using pClamp software (Axon Instruments). Whole cell configuration patch clamp data were filtered at 1 kHz and sampled at 10 kHz. Unless stated otherwise, the voltage step pulse was applied from −100 mV to 180 mV in 20 mV increments during 150 ms and holding potential was given at −60 mV. For the voltage ramp pulse, the same range of voltage steps was applied with 500 ms duration. The resistances of pipettes for whole cell and ciliary patch clamp were 6–8 MΩ and 18–24 MΩ, respectively. The tip of the pipette was further polished using Narishige MF-830 microforge equipped with a 100× Nikon objective. For patch clamp experiment, the extracellular solution consisted of (mM): 145 Na-gluconate, 5 KCl, 2 CaCl2, 5 MgCl2, 10 HEPES, and adjusted to pH 7.4 using NaOH. The intracellular solution was used as follows: 90 NaMES, 10 NaCl, 2 MgCl2, 10 HEPES, 5 EGTA, 100 nM free calcium adjusted by CaCl2, and adjusted to pH 7.4 using NaOH. The free calcium was calculated using CaBuf software (G.Droogmans, Leuven, Belgium). For calcium permeability test, the extracellular solution consisted of (mM): 2 mM CaCl2 and 10 HEPES adjusted to pH 7.4 using Trizma base and adjusted to 295mOsm using mannitol. The intracellular solution consisted of (mM): 10 HEPES and 1 EGTA adjusted to pH 7.4 Trizma base.

Statistical and data analysis for electrophysiology

Request a detailed protocol

Ciliary excised patch clamp data and whole cell configuration patch clamp were analyzed with Clampfit10.6 (Axon Instruments/Molecular Devices), Origin8 (Originlab), and Prism10.0 (Graphpad). Data are shown as mean ± SEM, and n represents independent experiments for the number of tested cells in electrophysiology. For relative open probability of sPC-1-PC-2F604P, the data obtained at −80 mV tail pulse were fitted to a Boltzmann distribution using Origin8 (Originlab).

P o(V) = P-100 +(P+180−P-100 )/(1+exp[(V 1/2 −V)/κ]) where P-100 and P+180 are the open probabilities of the channel at the most negative potential (−100 mV) and the most positive potential (+180 mV), respectively. V indicates the membrane potential, V1/2 is the half-maximal activation potential, and κ is the slope factor. For single channel open probability, Popen was calculated by:


where the total time that the channel presented in the open state and T is the total observation time. If a patch contains more than one of the same type of channel, Popen was computed by:


where, N indicates the number of channels in the patch. We used the following equation to populate data.


where, L indicates the level of the channel opening. The absolute probability of the channel being open NPo is computed by:


where, Tc indicates the total closed time

Ca2+-imaging in primary cilia

Request a detailed protocol

IMCD3 cells expressing Arl13b-mScarlet-GCaMP6 in primary cilia were imaged as described previously (Ishikawa and Marshall, 2015). In brief, cells were grown in the bottom side of 24 mm transwell insert with 8 um mesh size allowing rapid exchange of fluids across the membrane. Cilia were observed under an inverted Nikon microscope equipped with an TIRF imaging setup. Images were acquired 1 min after applying 1 μg/mL PC-1 NTF into the transwell. This assay allowed fast imaging along the entire length of the cilium. In most cases, cilia were localized by 561 nm (mScarlet) excitation and imaged in 488 nm (GCaMP6) and using the full CCD chip (200 ms exposure; five fps). Fluorescence was quantified and processed using ImageJ and Python.

Expression of N-terminal fragments of PC-1

Request a detailed protocol

Constructs were designed to produce various PC-1 N-terminal fragments as secreted proteins in HEK293S GnT1-/- cells using the BacMam expression system. In brief, the endogenous signal sequence of PC-1 was replaced with the strong IgG kappa leader peptide followed by either a M1-FLAG epitope or a maltose-binding protein fusion that allows for affinity purification using anti-M1 Flag antibody or amylose resin, respectively. HEK293S GnT1-/- cells were transduced with baculoviruses when cell density reaches 1 – 2 × 106 cells/mL. Sodium butyrate was added to at a final concentration of 5 mM to enhance protein expression 8–12 hr post-transduction. Temperature was reduced to 30°C and the supernatant was harvested 5 days post-transduction. Various PC-1 N-terminal fragments were purified by affinity chromatography whereby secreted PC-1 fragments were captured by passing supernatant through affinity resins using gravity. The purified PC-1 fragments were then exchanged to a buffer containing 20 mM HEPES, 150 mM NaCl, pH 7.4 via extensive dialysis at 4C. PC-1 N-terminal fragments were then flash-frozen in liquid nitrogen and stored as aliquots at −80°C until use.

Data analysis

Request a detailed protocol

Group data are presented as mean ± SEM. Statistical comparisons were made using unpaired student t-tests for electrophysiology and quantification of surface expression. The Mann-Whitney U-test was used for comparing peak area of Ca2+ signals and Fisher’s exact test was used for comparing # of Ca2+ peaks (Prism). Statistical significance is denoted with an asterisk (*p<0.05; **p<0.01).

Data availability

Previously published data from PDB was used, available under the accession code 6A70. All data generated or analysed during this study are included in the manuscript and supporting files.

The following previously published data sets were used
    1. Su Q
    2. Hu F
    3. Ge X
    4. Lei J
    5. Yu S
    6. Wang T
    7. Zhou Q
    8. Mei C
    9. Shi Y
    (2018) RCSB Protein Data Bank
    ID 6A70. Structure of the human PKD1/PKD2 complex.


Decision letter

  1. Polina V Lishko
    Reviewing Editor; University of California, Berkeley, United States
  2. Richard W Aldrich
    Senior Editor; The University of Texas at Austin, United States
  3. Haoxing Xu
    Reviewer; University of Michigan, United States

In the interests of transparency, eLife publishes the most substantive revision requests and the accompanying author responses.

Acceptance summary:

The polycystin complex, PKD1/PC-1 and PKD2/ PC-2, forms a cation channel in the primary cilia, but the gating and permeation properties were controversial, largely due to the technical difficulty in recording from ciliary membranes. In this manuscript by Ha et al., the authors have successfully, through various molecular manipulations, re-routed the PC1/PC2 protein complex to the plasma membrane of mammalian cells. It was demonstrated that the N-terminal extracellular domain (NTF) of PC1, when proteolytically cleaved, may serve as an endogenous agonist of the heteromeric PC1/PC2 channel. The results have provided another platform for studying the regulation of PC1/PC2 by endogenous cellular cues acting on the primary cilia. Additionally, it has made it possible to conduct high-throughput screening of small-molecule PC1/PC2 modulators, which can reveal novel therapeutic approaches to treat ciliary diseases.

Decision letter after peer review:

Thank you for submitting your article "The heteromeric PC-1/PC-2 polycystin complex is activated by the PC-1 N-terminus" for consideration by eLife. Your article has been reviewed by three peer reviewers, and the evaluation has been overseen by a Reviewing Editor and Richard Aldrich as the Senior Editor. The following individual involved in review of your submission has agreed to reveal their identity: Haoxing Xu (Reviewer #1).

The reviewers have discussed the reviews with one another and the Reviewing Editor has drafted this decision to help you prepare a revised submission.

We would like to draw your attention to changes in our revision policy that we have made in response to COVID-19 (https://elifesciences.org/articles/57162). Specifically, when editors judge that a submitted work as a whole belongs in eLife but that some conclusions require a modest amount of additional new data, as they do with your paper, we are asking that the manuscript be revised to either limit claims to those supported by data in hand, or to explicitly state that the relevant conclusions require additional supporting data.

Our expectation is that the authors will eventually carry out the additional experiments and report on how they affect the relevant conclusions either in a preprint on bioRxiv or medRxiv, or if appropriate, as a Research Advance in eLife, either of which would be linked to the original paper.


In this manuscript, Ha et al., report a successful reconstitution of the ciliary polycystin PC-1/PC-2 complex in mammalian cells. They show that the complex forms a cation channel that mediates an outwardly rectifying ion current in the plasma membrane. Moreover, this study demonstrates that soluble N-terminal extracellular domain of PC-1 can activate the channel and act as an endogenous agonist. These findings are corroborated by state-of-the-art electrophysiological recording and calcium imaging of cilia. The results are significant, because they have provided another platform for studying the regulation of PC1/PC2 by endogenous cellular cues acting on the primary cilia. Additionally, it has made it possible to conduct high-throughput screening of small-molecule PC1/PC2 agonists and inhibitors, which may provide not only some studying tools, but also possible therapeutic approaches to treat autosomal dominant polycystic kidney disease (ADPKD). Taken together, the research provides strong evidence for functional PC-1/PC-2 complex and novel mechanistic insight to understand mechanism of ADPKD.

Revisions for this paper:

1) There is some background, outwardly rectifying TRPM7-like currents in most mammalian cell lines, including HEK293 cells. Hence, it is less convincing to compare the results from different recordings/cells under different experimental conditions, even if blind experiments are conducted. Have authors tried bath-application of NTF peptides in the whole-cell recordings of sPC-1/PC2 or sPC-1/PC2-F604P-expressing cells, to see whether you can see the current activation and washout in the same cells?

2) In Figure 5F, authors may consider to boost the Ca2+ signal by increasing the extracellular Ca2+ concentration. Have authors tried bath-application of NTF peptides to PC1/PC2 overexpressing mIMCD3 cells in the GCaMP imaging experiments?

3) One major point that needs to be addressed is the labeling of the different constructs and how they are cited in the text/legends or the figures. This creates major confusion and needs to be carefully checked throughout the whole manuscript. See the specifics below.

4) Figure 1A: PC-1 should be sPC-1?

5) Figure 1B, C, D: second panel – PC-1 is HA-PC-1?

6) Figure 2B: sPC is missing for all panels – please make sure that all figures are labeled with the same construct names – the labeling seems to be all over the place (also see below).

7) Figure 2D: the constructs again have different names, which are not explained in the legend or the text.

8) Figure 2C, please double check whether there is no error in scale bar and unify them for easy comparison. Weak currents are elicited in PC-1L3 and PC-11L3NT. These are different with residual current from PC-1ΔNT and PC-11L3CTL. PC-1ΔNT seems to be also responsive to voltage change because it has tail currents, indicating potential changes in channel conformation. If so, loss of N-terminus of PC-1 does not seem to alter voltage sensing of the polycystin complex.

9) Not all claims in the text are justified by the data shown in the figures.

10) Subsection “PC-1 and PC-2 form functional channels in the plasma membrane”, first paragraph: Figure 1—figure supplement 1E does not show sPC-1 and/or sPC-2 expression – please show images for IMCD-3 cells.

11) Figure 1—figure supplement 1B: labeling against HA for PC-1 is missing. For quantification, a ratio of the extracellular HA and flag signal should be calculated, demonstrating that they are shuttled simultaneously into the PM (subsection “PC-1 and PC-2 form functional channels in the plasma membrane”, first paragraph).

12) Subsection “PC-1 and PC-2 form functional channels in the plasma membrane”, second paragraph: while the authors' conclusion that PC-1 contributes to the pore of the channel complex and PC-1/PC-2 subunits form a functional channel is valid, it is not clear how the open probability is calculated here. Figure 1K does not show channel open probability (it is a normalized I/V curve) – I/Imax cannot serve as Po. GV curve is commonly used to present channel conductance. Besides, they are normalized by their own Imax, thus the curve is not comparable to each other. It is also unusual that the authors try to obtain open probability at negative command voltage, not positive, for the outwardly rectifying channel?

13) Subsection “The PC-1 N-terminus is essential for polycystin complex activation”, first paragraph: Figure 2B does not provide any data for PC-2F604P transfected cells – are the panels and the legend correct? If yes, then the data for the mutant needs to be shown.

14) No images analyzing the plasma membrane localization are shown for PC-1L3/1CTL – please provide the data.

15) Current traces for PC-1ΔNT;PC-2F604P are missing in Figure 2 – please provide the data.

16) Subsection “The PC-1 N-terminus is essential for polycystin complex activation”, last paragraph: pore mutant is not show in Figure 2F, at least the legend does not indicate that this construct has been used. Please comment or include the data set.

17) Subsection “The PC-1 N-terminus is essential for polycystin complex activation”, last paragraph: where is the condition PC-1L2s1NT;PC-2F604P? The traces in Figure 2C do not show this data set and the labeling in 2C and D is different.

18) Subsection “Polycystin activation depends on CTL and TOP domains”, first paragraph, please indicate the voltage. Also please use the protein names in the text consistent with the labels in Figures (Figure 2C). Is signal pipette replaced in PC-1 used here?

19) Subsection “Polycystin activation depends on CTL and TOP domains”, second paragraph: when comparing the data in Figure 3B to the data in Figure 1C, there seems to be a difference (opposite to what is written in the text) – please perform statistical analysis between the two conditions.

20) Missing information about the concentration of the purified NT domains – how much was added for the different measurements? Has the protein been added in excess or in stochiometric amounts?

21) Some ephys data are loosely formatted to support the authors' conclusion, which the authors need to consider to better re-present by more careful analysis and/or text revision.

22) Figure 5. Here, the authors also obtained open probability in panel D. Is it calculated in the same way as Figure 1 or from single channel conductance?

Revisions expected in follow-up work:

As mentioned in ("Revisions for this paper" section #1) similar experiments could also be performed in the whole-cilium (or out-side-out) recordings. The significance of the study can be further boosted if you can see PC-1/PC-2 current activation by a protease cocktail, e.g., trypsin. However, such experiments are not required for the revision.


Author response

Revisions for this paper:

1) There is some background, outwardly rectifying TRPM7-like currents in most mammalian cell lines, including HEK293 cells. Hence, it is less convincing to compare the results from different recordings/cells under different experimental conditions, even if blind experiments are conducted. Have authors tried bath-application of NTF peptides in the whole-cell recordings of sPC-1/PC2 or sPC-1/PC2-F604P-expressing cells, to see whether you can see the current activation and washout in the same cells?

We agree with the reviewer that endogenous currents, especially TRPM7-mediated currents, can easily be misinterpreted as currents generated by overexpressed channel. Hence we have taken great care to eliminate the contribution of TRPM7: In order to block endogenous TRPM7 currents we added 5 mM MgCl2 to the extracellular and 1 mM MgCl2 to the intracellular solution. In none of our recordings did we ever observe a “run-up” of currents over time, a hallmark of TRPM7-mediated currents. In the revised manuscript we now include data showing that acute perfusion of sPC-1ΔNT/PC-2F604P expressing cells with PC1-NTF potentiates polycystin currents in whole-cell recordings.

This data is now included in Figure 3D. Further, as suggested by the reviewers, we also tested whether trypsin digestion of PC-1 N-terminus reduces polycystin currents. As shown in Figure 3H, acute perfusion with trypsin inhibits polycystin dependent currents, likely by removing PC-1 N-terminus from sPC-1/PC-2F604P expressing cells. These findings are further supporting our hypothesis that PC-1 N-terminus and C-type lectin domain are critical for channel activity.

2) In Figure 5F, authors may consider to boost the Ca2+ signal by increasing the extracellular Ca2+ concentration. Have authors tried bath-application of NTF peptides to PC1/PC2 overexpressing mIMCD3 cells in the GCaMP imaging experiments?

We agree with the reviewer that acute perfusion of primary cilia with PC-1 NTF would be ideal. However we have been using a TIRF imaging system at the Nikon Imaging Core, which is not set up for perfusion. Due to the reduced staffing of the core we have no possibility to upgrade the system anytime soon. Further, as described in the Materials and methods section, TIRF imaging modality requires us to image cilia on cells grown on inverted transwell dishes.

3) One major point that needs to be addressed is the labeling of the different constructs and how they are cited in the text/legends or the figures. This creates major confusion and needs to be carefully checked throughout the whole manuscript. See the specifics below.

Following the reviewers’ suggestion we have now included a table (Table 1) with a detailed description of all constructs, including the exact amino acid position for chimeras or insertion (14 constructs in total, four of which address chimeras between PC-1 and PC-1L3).

4) Figure 1A: PC-1 should be sPC-1?

We corrected Figure 1A accordingly.

5) Figure 1B, C, D: second panel – PC-1 is HA-PC-1?

We corrected Figure 1B, C, D accordingly.

6) Figure 2B: sPC is missing for all panels – please make sure that all figures are labeled with the same construct names – the labeling seems to be all over the place (also see below).

That you for pointing this out. We unified labeling across all figures, including panels in Figure 2B.

7) Figure 2D: the constructs again have different names, which are not explained in the legend or the text.

We unified labeling of the constructs and now refer to a detailed description of all constructs in Table 1 (see above).

8) Figure 2C, please double check whether there is no error in scale bar and unify them for easy comparison. Weak currents are elicited in PC-1L3 and PC-11L3NT. These are different with residual current from PC-1ΔNT and PC-11L3CTL. PC-1ΔNT seems to be also responsive to voltage change because it has tail currents, indicating potential changes in channel conformation. If so, loss of N-terminus of PC-1 does not seem to alter voltage sensing of the polycystin complex.

Thank you for noticing this apparent inconsistency. We have now unified the scale for each recording. Upon close examination we realize that the apparent tail currents from PC-1ΔNTF+PC2 F604P recordings were not a direct consequence of channel expression. We have now addressed this issue and show that the PC-1ΔNTF+PC2 F604P construct does not show apparent voltage sensitivity.

9) Not all claims in the text are justified by the data shown in the figures.

We carefully adjusted all claims to the data presented in the manuscript. We also modified the Discussion accordingly.

10) Subsection “PC-1 and PC-2 form functional channels in the plasma membrane”, first paragraph: Figure 1—figure supplement 1E does not show sPC-1 and/or sPC-2 expression – please show images for IMCD-3 cells.

Figure 1—figure supplement 1E showed the ciliary localization of PC-1ΔNT and PC-2FLAG using surface HA or surface FLAG staining. This was to emphasize the point that in ciliated cells the proteins still enrich in their native environment. We now included one set of images showing that sPC1 also enriches in the cilium, when present.

11) Figure 1—figure supplement 1B: labeling against HA for PC-1 is missing. For quantification, a ratio of the extracellular HA and flag signal should be calculated, demonstrating that they are shuttled simultaneously into the PM (subsection “PC-1 and PC-2 form functional channels in the plasma membrane”, first paragraph).

Over the course of many experiments we noted that simultaneous labeling with anti HA and anti FLAG antibodies results in varying and unpredictable degrees of surface staining for HA or FLAG. We currently hypothesize that due to steric hindrance both antibodies may exclude each other from binding to the extracellular tags. We realized that quantification of surface HA or surface FLAG staining, which has been processed separately but is from the same set of transfected cells, is the most reliable approach. We have added a set of images for surface cilia surface staining of sPC-1/PC-2 expressing IMCD3 cells, see above

12) Subsection “PC-1 and PC-2 form functional channels in the plasma membrane”, second paragraph: while the authors' conclusion that PC-1 contributes to the pore of the channel complex and PC-1/PC-2 subunits form a functional channel is valid, it is not clear how the open probability is calculated here. Figure 1K does not show channel open probability (it is a normalized I/V curve) – I/Imax cannot serve as Po. GV curve is commonly used to present channel conductance. Besides, they are normalized by their own Imax, thus the curve is not comparable to each other. It is also unusual that the authors try to obtain open probability at negative command voltage, not positive, for the outwardly rectifying channel?

We are sorry for the confusion. We agree with the reviewer that the labeling of the figure was not precise. Here we are comparing the relative open probability between both channels and calculated the relative open probability based on inward currents at the tail pulse -80mV for each of the voltage steps. Further we now include statistical analysis at representative voltages.

13) Subsection “The PC-1 N-terminus is essential for polycystin complex activation”, first paragraph: Figure 2B does not provide any data for PC-2F604P transfected cells – are the panels and the legend correct? If yes, then the data for the mutant needs to be shown.

We included sPC-1/PC-2 F604P data in Figures 1B and C. In none of the experiments did we notice a major difference in surface trafficking between wtPC-2 and the F604P mutant, see also Figure 1C. We thus used PC-2 for quantification.

14) No images analyzing the plasma membrane localization are shown for PC-1L3/1CTL – please provide the data.

Imaging analysis data for PC-1L3/1CTL is included in Figure 2D.

15) Current traces for PC-1ΔNT;PC-2F604P are missing in Figure 2 – please provide the data.

Current traces for PC-1ΔNT and PC-2F604P has been included in Figure 2C.

16) Subsection “The PC-1 N-terminus is essential for polycystin complex activation”, last paragraph: pore mutant is not show in Figure 2F, at least the legend does not indicate that this construct has been used. Please comment or include the data set.

The pore mutant for sPC-1/PC-2F604P data set was already shown in the Figure 1K. We now updated the figure legend.

17) Subsection “The PC-1 N-terminus is essential for polycystin complex activation”, last paragraph: where is the condition PC-1L2s1NT;PC-2F604P? The traces in Figure 2C do not show this data set and the labeling in 2C and D is different.

We have not included any data for PC-1L2. As of now we could not obtain reliable HA surface staining with sPC-1L2 and PC-2. We also did not measure any macroscopic currents with sPC-1L2+PC-2F604P.

18) Subsection “Polycystin activation depends on CTL and TOP domains”, first paragraph, please indicate the voltage. Also please use the protein names in the text consistent with the labels in figures (Figure 2C). Is signal pipette replaced in PC-1 used here?

We now mention the voltage pulse (+100 mV). As discussed above we also updated the name of the constructs used in this study, see Table 1. And yes, the construct contains the secretion sequence (sPC-1).

19) Subsection “Polycystin activation depends on CTL and TOP domains”, second paragraph: when comparing the data in Figure 3B to the data in Figure 1C, there seems to be a difference (opposite to what is written in the text) – please perform statistical analysis between the two conditions.

The reviewer noticed the difference in y axis, thank you very much. The initial discrepancy in values resulted from the fact that the images were taken from different experiments and different microscopes. We now provide data in which we analyzed surface expression of sPC-1/PC-2 and the N375Q mutant under identical settings and performed statistical analysis.

20) Missing information about the concentration of the purified NT domains – how much was added for the different measurements? Has the protein been added in excess or in stochiometric amounts?

We had mentioned the concentration of the purified NTF domain in the subsection “N-terminal PC-1 fragments activate ciliary polycystin complexes”. We used 0.7 μg/mL (equal to ~50 nM final concentration) of NTF263-535 in the recording pipette and the same amount of the protein was applied for the calcium imaging.

21) Some ephys data are loosely formatted to support the authors' conclusion, which the authors need to consider to better re-present by more careful analysis and/or text revision.

We are sorry that the reviewer was under this impression. We had purposely omitted details in the manuscript in order to improve readability. As already discussed above we have now reformatted our figures for a more homogenous presentation.

22) Figure 5. Here, the authors also obtained open probability in panel D. Is it calculated in the same way as Figure 1 or from single channel conductance?

The open probability presented in the Figure 5D was obtained using single channel conductance.

Popen was computed by:

Popen=toT where to indicates the total time for the channel in the open state and T indicates the total observation time. This equation applied only for a single channel in the patch. If a patch contains multiple channel with the same type, we applied the equation below: Popen=toNT where N is the number of channels in the patch, and: To=Lto where L is the level of the channel opening. The absolute probability of the channel being open NPo is computed by: NPo=ToTo+Tc where Tc indicates the total closed time. We have now added a detailed description of how we obtained open probability in the Materials and methods section.

Revisions expected in follow-up work:

As mentioned in ("Revisions for this paper" section #1) similar experiments could also be performed in the whole-cilium (or out-side-out) recordings. The significance of the study can be further boosted if you can see PC-1/PC-2 current activation by a protease cocktail, e.g., trypsin. However, such experiments are not required for the revision.

We followed the reviewer’s suggestion and perfused HEK cells expressing sPC-1/PC-2F604P with 0.125% trypsin This test resulted in the significant reduction of the currents (8.9 ± 1.4 pA/pF,) n=6 from sPC-1/PC-2F604P (52.0 ± 17.1 pA/pF, n=6) by 78.4 ± 4.9 %. In contrast, untransfected cells did not show any significant decrease after trypsin application. We suggest that trypsin addition digested the PC-1 N-terminus and thus ultimately behaves like PC-1ΔNT. We added these results in the revised Figure 3H-K.


Article and author information

Author details

  1. Kotdaji Ha

    Department of Physiology, University of California, San Francisco, San Francisco, United States
    Conceptualization, Formal analysis, Validation, Investigation, Visualization, Methodology, Writing - original draft, Project administration, Writing - review and editing
    Competing interests
    No competing interests declared
  2. Mai Nobuhara

    Department of Physiology, University of California, San Francisco, San Francisco, United States
    Formal analysis, Validation, Investigation, Visualization, Methodology, Project administration
    Competing interests
    No competing interests declared
  3. Qinzhe Wang

    Department of Biochemistry, University of Utah School of Medicine, Salt Lake City, United States
    Resources, Formal analysis, Investigation, Visualization, Methodology
    Competing interests
    No competing interests declared
  4. Rebecca V Walker

    Division of Nephrology, Department of Medicine, University of Maryland School of Medicine, Baltimore, United States
    Resources, Investigation
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-2473-4303
  5. Feng Qian

    Division of Nephrology, Department of Medicine, University of Maryland School of Medicine, Baltimore, United States
    Resources, Supervision, Funding acquisition, Writing - original draft
    Competing interests
    No competing interests declared
  6. Christoph Schartner

    Department of Physiology, University of California, San Francisco, San Francisco, United States
    Resources, Visualization, Methodology
    Competing interests
    No competing interests declared
  7. Erhu Cao

    Department of Biochemistry, University of Utah School of Medicine, Salt Lake City, United States
    Conceptualization, Resources, Formal analysis, Supervision, Funding acquisition, Methodology, Writing - original draft, Writing - review and editing
    Competing interests
    No competing interests declared
  8. Markus Delling

    Department of Physiology, University of California, San Francisco, San Francisco, United States
    Conceptualization, Resources, Formal analysis, Supervision, Funding acquisition, Investigation, Visualization, Methodology, Writing - original draft, Writing - review and editing
    For correspondence
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0001-9556-2097


National Institute of General Medical Sciences (R01GM130908)

  • Markus Delling

Fritz Thyssen Stiftung

  • Markus Delling

National Research Foundation of Korea (2019R1A6A3A03033302)

  • Kotdaji Ha

National Institute of Diabetes and Digestive and Kidney Diseases (R01 DK125404)

  • Feng Qian

National Institute of Diabetes and Digestive and Kidney Diseases (U54DK126114)

  • Feng Qian

National Institute of Diabetes and Digestive and Kidney Diseases (DK110575)

  • Erhu Cao

PKD Foundation (236G19a)

  • Feng Qian

PKD Foundation (215F19a)

  • Rebecca V Walker

National Institute of Diabetes and Digestive and Kidney Diseases (R01 DK111611)

  • Feng Qian

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.


This work was supported by National Institute of Health Grant R01GM130908 (MD), R01 DK111611 (FQ), Polycystic Kidney Disease Research Resource Consortium U54DK126114 (FQ), the Fritz Thyssen Foundation (MD), the National Research Foundation of Korea (NTF) grant funded by the Korean government (MSIT) (No.2019R1A6A3A03033302) (KH), PKD Foundation (236G19a) (FQ) and a fellowship grant (215F19a) (RW). EC has been supported by NIH grant R01 DK110575 and is a Pew scholar supported by the Pew Charitable Trusts.

We thank John King for help with the analysis of single channel recordings and Yuriy Kirichok for advice on electrophysiology. We are grateful to Julia Doerner, David Clapham, Ray Hulse, and Anthony Marantos for their critical reading of the manuscript and helpful discussions.

Senior Editor

  1. Richard W Aldrich, The University of Texas at Austin, United States

Reviewing Editor

  1. Polina V Lishko, University of California, Berkeley, United States


  1. Haoxing Xu, University of Michigan, United States

Publication history

  1. Received: July 2, 2020
  2. Accepted: November 6, 2020
  3. Accepted Manuscript published: November 9, 2020 (version 1)
  4. Accepted Manuscript updated: November 12, 2020 (version 2)
  5. Version of Record published: December 10, 2020 (version 3)


© 2020, Ha et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.


  • 1,262
    Page views
  • 316
  • 2

Article citation count generated by polling the highest count across the following sources: Crossref, PubMed Central, Scopus.

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Downloads (link to download the article as PDF)

Download citations (links to download the citations from this article in formats compatible with various reference manager tools)

Open citations (links to open the citations from this article in various online reference manager services)

Further reading

    1. Cell Biology
    2. Stem Cells and Regenerative Medicine
    Emma Carley et al.
    Research Article Updated

    While the mechanisms by which chemical signals control cell fate have been well studied, the impact of mechanical inputs on cell fate decisions is not well understood. Here, using the well-defined system of keratinocyte differentiation in the skin, we examine whether and how direct force transmission to the nucleus regulates epidermal cell fate. Using a molecular biosensor, we find that tension on the nucleus through linker of nucleoskeleton and cytoskeleton (LINC) complexes requires integrin engagement in undifferentiated epidermal stem cells and is released during differentiation concomitant with decreased tension on A-type lamins. LINC complex ablation in mice reveals that LINC complexes are required to repress epidermal differentiation in vivo and in vitro and influence accessibility of epidermal differentiation genes, suggesting that force transduction from engaged integrins to the nucleus plays a role in maintaining keratinocyte progenitors. This work reveals a direct mechanotransduction pathway capable of relaying adhesion-specific signals to regulate cell fate.

    1. Cell Biology
    Hongyan Hao et al.
    Research Article

    KASH proteins in the outer nuclear membrane comprise the cytoplasmic half of LINC complexes that connect nuclei to the cytoskeleton. Caenorhabditis elegans ANC-1, an ortholog of Nesprin-1/2, contains actin-binding and KASH domains at opposite ends of a long spectrin-like region. Deletion of either the KASH or calponin homology (CH) domains does not completely disrupt nuclear positioning, suggesting neither KASH nor CH domains are essential. Deletions in the spectrin-like region of ANC-1 led to significant defects, but only recapitulated the null phenotype in combination with mutations in the trans-membrane span. In anc-1 mutants, the ER, mitochondria, and lipid droplets were unanchored, moving throughout the cytoplasm. The data presented here support a cytoplasmic integrity model where ANC-1 localizes to the ER membrane and extends into the cytoplasm to position nuclei, ER, mitochondria, and likely other organelles in place.