Hedgehog signaling is required for endomesodermal patterning and germ cell development in the sea anemone Nematostella vectensis

  1. Cheng-Yi Chen
  2. Sean A McKinney
  3. Lacey R Ellington
  4. Matthew C Gibson  Is a corresponding author
  1. Stowers Institute for Medical Research, United States
  2. Department of Anatomy and Cell Biology, The University of Kansas School of Medicine, United States

Abstract

Two distinct mechanisms for primordial germ cell (PGC) specification are observed within Bilatera: early determination by maternal factors or late induction by zygotic cues. Here we investigate the molecular basis for PGC specification in Nematostella, a representative pre-bilaterian animal where PGCs arise as paired endomesodermal cell clusters during early development. We first present evidence that the putative PGCs delaminate from the endomesoderm upon feeding, migrate into the gonad primordia, and mature into germ cells. We then show that the PGC clusters arise at the interface between hedgehog1 and patched domains in the developing mesenteries and use gene knockdown, knockout and inhibitor experiments to demonstrate that Hh signaling is required for both PGC specification and general endomesodermal patterning. These results provide evidence that the Nematostella germline is specified by inductive signals rather than maternal factors, and support the existence of zygotically-induced PGCs in the eumetazoan common ancestor.

Introduction

During development, animal embryos typically set aside a group of primordial germ cells (PGCs) that later mature into germline stem cells (GSCs) and in turn give rise to gametes during adulthood (Nieuwkoop and Sutasurya, 1979; Nieuwkoop and Sutasurya, 1981; Wylie, 1999; Juliano et al., 2010). The process of PGC specification both underpins the sexual reproduction cycle and involves transitions of pluripotency, making the mechanisms that distinguish germ cells from soma of critical importance in developmental and stem cell biology (Solana, 2013; Irie et al., 2014; Magnúsdóttir and Surani, 2014). PGC specification occurs early in development and could hypothetically rely on autonomous or non-autonomous cues. Historically, comparative studies of germ cell development defined the core mechanisms of PGC specification as preformation and epigenesis (Nieuwkoop and Sutasurya, 1979; Nieuwkoop and Sutasurya, 1981; Extavour and Akam, 2003). For clarity, here we adopt the terms ‘inherited’ and ‘induced’ to distinguish between PGC specification mechanisms (Seydoux and Braun, 2006; and Seervai and Wessel, 2013). In inherited PGC specification (e.g. Drosophila, C. elegans and Danio rerio), cytoplasmic determinants referred to as the germ plasm are maternally deposited in oocytes and then segregated into specific blastomeres through cell division (Strome and Wood, 1982; Williamson and Lehmann, 1996; Yoon et al., 1997). In contrast, there are neither maternal germline determinants nor pre-determined PGC fates in specific blastomeres in inductive PGC specification. For example, BMP signaling is required for PGC specification from precursor cells in mouse, axolotl, and cricket embryos (Lawson et al., 1999; Chatfield et al., 2014; Nakamura and Extavour, 2016). The inductive mode of PGC specification is more prevalent across the animal kingdom, and therefore hypothesized to reflect mechanisms present in the cnidarian-bilaterian common ancestor (Extavour and Akam, 2003).

Strictly categorizing PGC specification mechanisms into one of two types may fail to account for the true variety present in nature. Highly regenerative animals such as sponge, Hydra and planaria maintain multipotent stem cells that are capable of differentiating into both soma and germ line in adults (Bosch and David, 1987; Fierro-Constaín et al., 2017; Issigonis and Newmark, 2019), thus representing an alternative post-embryonic mode of PGC specification. In sea urchin, a combination of inherited and inductive PGC specification mechanisms are observed (Voronina et al., 2008). It follows that the germline determination mechanisms of a wide variety of organisms may lie at different positions along the continuum between maternal inheritance and zygotic induction (Nieuwkoop and Sutasurya, 1981; Seervai and Wessel, 2013).

Cnidarians (jellyfish, sea anemones and corals) are the sister group to bilaterians and occupy an ideal phylogenetic position for investigating likely developmental traits of the eumetazoan common ancestor (Technau and Steele, 2011; Russell et al., 2017). Among cnidarians, the sea anemone Nematostella vectensis maintains distinct adult gonad tissue and features PGC specification dynamics hypothesized to reflect an evolutionary transition from induction to inherited mechanism based on expression patterns of conserved germline genes (Extavour et al., 2005). Additionally, a well-annotated genome (Putnam et al., 2007), defined developmental stages (Fritzenwanker et al., 2007) and diverse genetic tools (Ikmi et al., 2014; Renfer and Technau, 2017; He et al., 2018; Karabulut et al., 2019) make Nematostella a genetically tractable model to elucidate developmental mechanisms controlling PGC specification.

In this study, we explore mechanisms of PGC development in Nematostella and test whether the putative PGC clusters are specified by maternal or zygotic control. We first follow the development of putative PGCs and provide evidence supporting their germ cell fate in adults. We then leverage shRNA knockdown and CRISPR/Cas9 mutagenesis to interrogate the developmental requirements for the Hedgehog signaling pathway in PGC specification. From these results, we conclude that Hh signaling is either directly or indirectly required for PGC specification in Nematostella. As Hh signaling is only activated zygotically, these data indicate an inductive mechanism for Nematostella PGC specification and support the inference that the eumetazoan common ancestor likely specified PGCs via zygotic induction.

Results

Evidence that PGCs form in primary polyps and migrate to gonad rudiments

The localized expression of the conserved germline genes vasa and piwi suggest that Nematostella PGCs arise during the metamorphosis of planula larvae into primary polyps between 4 and 8 days-post-fertilization (dpf; Figure 1A–D’’; Extavour et al., 2005; Praher et al., 2017). These cells first appear as discrete clusters within the two primary mesenteries, in close proximity to the pharynx (Figure 1B–D’’). To follow the development of putative PGCs at higher spatio-temporal resolution, we generated a polyclonal antibody against Nematostella Vasa2 (Vas2) and used immunohistochemistry and fluorescent in situ hybridization to confirm that Vas2 was co-expressed with piwi1 and piwi2 in the putative PGC clusters (Figure 1—figure supplement 1A–L). Further supporting their germline identity, we also found that tudor was enriched in putative PGC clusters (Figure 1—figure supplement 1M–P; Boswell and Mahowald, 1985; Arkov et al., 2006; Chuma et al., 2006). We next quantified the number of putative PGCs in primary polyps and found that Vas2+ cell numbers varied between individuals, with a median number of 10 cells per primary polyp (Figure 1E). We did not observe a significant difference in Vas2+ cell numbers between two primary mesenteries (Figure 1—figure supplement 2). Within the same spawning batch, there was no significant difference in the number of putative PGCs in primary polyps assayed on different days. This suggests that there was neither loss nor expansion of PGCs in primary polyps prior to feeding and development of the juvenile stage.

Figure 1 with 2 supplements see all
Putative Nematostella PGCs clusters are specified during metamorphosis.

(A) Diagram depicting the Nematostella life cycle. (B–D’’) During the transition from tentacle bud stage larvae to metamorphic primary polyps, Vas2 expression is gradually enriched in the primary mesenteries in two endomesodermal cell clusters in proximity to the pharynx. (E) Quantification of PGC numbers on 8, 12 or 16 dpf from three spawning batches. ANOVA analysis did not show significant differences among mean PGC number in primary polyps on different days post-fertilization. Center lines show the medians; box limits indicate the 25th and 75th percentiles; whiskers extend 1.5 times the interquartile range from the 25th and 75th percentiles; data points are plotted as open circles. Scale bar = 100 µm in D and D’; 50 µm in D’’. B–D’ are at the same scale; B’’–D’’ are at the same scale.

Figure 1—source data 1

PGC numbers on 8, 12 or 16 dpf from three spawning batches.

https://cdn.elifesciences.org/articles/54573/elife-54573-fig1-data1-v1.csv

Adult Nematostella harbor mature gonads in all eight internal mesentery structures while confocal images found that Vas2+ epithelial cell clusters were localized only at endomesodermal septa associated with segments s2 and s8 (Figure 2A–B’; Video 1; Figure 2—figure supplement 1; Williams, 1975; Frank and Bleakney, 1976; He et al., 2018). If the two Vas2+ epithelial cell clusters are the only precursors for adult germ cells, it follows that these cells would have to delaminate and migrate to populate the eight gonad rudiments. Alternatively, new PGCs could arise within each of the six non-primary mesenteries, perhaps at a later developmental stage. To distinguish between these possibilities, we examined the localization of Vas2-expressing putative PGCs in primary polyps and later juvenile stages. In all primary polyps, putative PGCs appeared in two coherent clusters at 8 dpf (Figure 2B–B’). In older primary polyps (>10 dpf), some PGC clusters cells appeared to stretch basally through the underlying mesoglea, an elastic extracellular matrix that separates epidermis and gastrodermis layers (Figure 2C–C’; Schmid, 1991; Shaposhnikova et al., 2005). After feeding for more than a week, primary polyps start adding tentacles and enter the juvenile stage. Interestingly, upon feeding, Vas2-expressing putative PGCs appeared to delaminate from the epidermis into the underlying mesoglea (Figure 2D–D’). Putatively delaminated Vas2 positive cells displayed a fibroblast-like morphology with pseudopodial protrusions, similar to other migratory cell types (Figure 2—figure supplement 2; Scarpa and Mayor, 2016). Further consistent with migratory potential, Vas2+ cells also expressed twist (Figure 2—figure supplement 3), a conserved regulator of mesoderm development and a marker of metastatic cancer cells (Yang et al., 2004; Kallergi et al., 2011). While specification of additional PGC clusters was not observed on the six non-primary mesenteries, we did find evidence for a process of radial cell migration between mesenteries at the level of the aboral end of the pharynx, where the mesoglea between ectoderm and endomesoderm increases in volume after the primary polyp stage (Figure 2E–E’).

Figure 2 with 3 supplements see all
Putative Nematostella PGCs delaminate through epithelial-mesenchymal transition (EMT) and appear to migrate to non-primary mesenteries.

(A) Schematic diagram of Nematostella polyp anatomy depicts the pharynx and mesentery arrangements at the pharyngeal level. The eight mesenteries (two primary mesenteries in orange and six non-primary mesenteries in light gray) harbor gonad epithelium, muscle and digestive tissue. The internal structures of Nematostella are arrayed around the pharynx (dark gray). The Directive and Oral-Aboral axes are indicated. Segment nomenclatures follow He et al., 2018. (B–B’) Paired clusters of putative PGCs labeled by Vas2 immunofluorescence (red) initially exhibit epithelial charateristics. (C–C’) Putative PGCs from >10 dpf primary polyps appear to stretch their cell bodies basally (yellow arrowheads). (D–D’) Following nutrient intake, putative PGCs delaminate into the mesoglea through an apparent EMT (yellow arrowhead). (E–E’) In the mesoglea, these Vas2+ cells exhibit fibroblast-like morphology and are detected between mesenteries at the level of the aboral pharynx. Scale bar = 50 µm in B, D, and E; 20 µm in C; 10 µm in B’, C’, D’, and E’.

Video 1
3D reconstruction of pharyngeal structures.

PGCs (magenta) are specified on the epithelium of the two primary mesenteries, close to the pharynx (cyan cells in the center). The endomesodermal nuclei are pseudocolored in blue, and the ectodermal nuclei are in cyan.

We next followed the localization of putative PGCs through successive developmental timepoints. The majority of 10 dpf primary polyps showed PGCs within clusters (Figure 3A–A’), while >10 dpf primary polyps showed some PGCs localized between the primary mesenteries and segment s1 (Figure 3B–B’). The direction of this initial migration toward segment s1 suggests the existence of attractive/repulsive signals for migratory PGCs. Additionally, we found that in juveniles putative PGCs migrated aborally toward the mesentery region where gonad rudiments will mature in adults (Figure 3C–D’). These migratory PGCs were proliferative as shown by Phospho-Histone H3 labeling and EdU incorporation (Figure 3—figure supplement 1). Combining all observations, we hypothesize that in Nematostella, putative PGCs initially form in primary polyps as two endomesodermal cell clusters at the level of the aboral pharynx. During juvenile stages, we further postulate that these cells delaminate into the mesoglea layer between the ectoderm and endomesoderm via an apparent epithelial-mesenchymal transition (EMT) and then migrate to the gonad rudiments.

Figure 3 with 1 supplement see all
Nematostella PGCs migrate aborally to the gonad rudiments during the juvenile stage.

(A–A’) The majority of young primary polyps (≤10 dpf) exhibit two PGC clusters (Vas2+, red) in close proximity to the pharynx. (B–B’) In more mature primary polyps (>10 dpf), some PGCs elongate and localize between the mesenteries. (C–C’) Following feeding, putative PGCs spread aborally into the gonad rudiments. (D–D’) A juvenile polyp viewed 90 degrees from the orientation of C, showing aborally migrating PGCs in non-primary mesenteries. Scale bar = 10 µm in A’ and B’; 20 µm in C’ and D’.

Evidence that putative PGCs mature and give rise to germ cells in adult gonads

To assess the germline identity of putative PGCs, we next followed the development of Vas2+ cells from juvenile to young adult stages (>2 month-old). In maturing polyps, the endomesodermal mesenteries are organized from proximal (external) to distal (internal) into parietal muscles, retractor muscles, gonads and septal filaments, with occasionally observed ciliated tracts between the gonads and septal filaments (Figure 4A–D; Williams, 1979; Jahnel et al., 2014). In juvenile polyps, Vas2+ cells were observed in the mesoglea between the septal filaments and the retractor muscles (Figure 4C), an endomesodermal region that will later form the adult gonad epidermis. We also occasionally observed putative PGCs between the ciliated tracts and the retractor muscles (Figure 4D). After feeding for 8 weeks, most polyps reached the 12-tentacle stage and the mesenteries progressively matured, becoming wider and thicker. At this stage we observed Vas2+ putative PGCs in the maturing gonad region, along with Vas2+ immature oocytes or sperm cysts in females and males, respectively (Figure 4E–F). In adult mesenteries, similar putative PGCs were found in the vicinity of oocytes and sperm stem cells (Figure 4—figure supplement 1A–C’) and in the aboral region of mesenteries (Figure 4—figure supplement 1D–E’, and summarized in Figure 4—figure supplement 1F). In the aboral regions, Vas2+ PGC-like cells exhibited proliferative capacity as evidenced by EdU incoporation (Figure 4—figure supplement 2). Taken together, these observations suggest that the putative PGCs comprise a continuous Vas2-expressing lineage that proliferates and ultimately gives rise to mature germ cells. As proposed by previous work (Extavour et al., 2005), these data support the hypothesis that the germline gene-expressing cell clusters of primary polyps represent bona fide PGCs of Nematostella.

Figure 4 with 2 supplements see all
Vas2+ germ cells in juvenile gonad rudiments.

(A) Schematic diagram of Nematostella polyp anatomy depicts the gametogenic mesenteries at the mid-body level. (B) A mid-body level cross section through a juvenile polyp, note the enlarged primary mesenteries (yellow arrows). Nuclei are counter stained by DAPI (green). (C and D) Representative images of maturing mesenteries with corresponding schematic diagrams. Putative PGCs are labeled by Vas2 immunofluorescence in red. (E) Whole-mount juvenile female mesentery shows Vas2-labeled putative PGCs and germ cells in close proximity (red), suggesting maturing oocytes originate from the continuous PGC lineage. (F) Whole-mount juvenile male mesentery shows Vas2-labeled putative PGC and germ cell populations, including the rudimentary sperm cysts. Insets 1–4 of E and F are xz plane views at the indicated levels. Scale bar = 100 µm in B; 20 µm in C–F.

Evidence supporting a zygotic mechanism for primordial germ cell specification

We next investigated whether Nematostella PGCs are specified by inheritance of maternal determinants or through induction by zygotically-expressed factors. In the inheritance-based mechanisms of other species, maternally-deposited germline determinants are segregated into specific PGC precursors during early cleavage (Nieuwkoop and Sutasurya, 1979; Nieuwkoop and Sutasurya, 1981; Extavour and Akam, 2003). In Nematostella, prior to the appearance of putative PGC clusters in developing polyps, we observed perinuclear Vas2 granules that could hypothetically serve as maternal germline determinants (Figure 5). These granules were previously identified with an independent antibody and proposed to regulate Nematostella piRNAs (Praher et al., 2017). However, the perinuclear Vas2 granules were distributed homogenously around oocyte germinal vesicles (Figure 5A), in every cell of blastulae, and in most endomesodermal cells after gastrulation (Figure 5B; Praher et al., 2017). In endomesodermal cells, Vas2+ granules gradually diminished when the putative PGC cluster cells activated Vas2 expression (Figure 5B–E’’), suggesting that germ cell fate was gradually specified in endomesodermal precursor cells rather than being maternally predetermined in a set of germline precursor cells. Furthermore, germline gene transcripts (i.e. vas1, vas2, nos2 and pl10) displayed a homogenous distribution in the endomesoderm of embryos and larva before PGC specification (Extavour et al., 2005). Endomesodermal enrichment of germline genes before Nematostella PGC formation could be consistent with the proposed germline multipotency program (GMP), where the expression of conserved germline factors underlies the multipotency of progenitor cells (Juliano et al., 2010). In line with the GMP hypothesis, we hypothesized that Nematostella PGCs are specified from a pool of multipotent endomesodermal precursors as observed in other species that use zygotic mechanisms to induce PGCs.

Maternally inherited perinuclear Vas2 granules diminish during PGC specification.

(A) Cross-section of female gonad. Vas2 protein (red) forms puncta that surround the nuclei of maturing oocytes (arrowhead). In addition, PGC-like cells (arrows) are found next to oocytes. Oocyte boundaries are delineated by dotted lines (white). Nuclei and nucleolus are counter stained by Hoechst (green). (B–E’’) Perinuclear Vas2 granules in endomesodermal cells gradually diminish as the PGC clusters are specified next to the pharynx during the tentacle bud through primary polyp stages. The pharynx is delineated by white lines and the boundary between ectoderm and endoderm is delineated by yellow-dotted lines. (B’–E’’) Enlarged views of boxed areas in B-E. B-E’ are single focal planes under the same imaging conditions. Scale bar = 50 µm in A–E; 10 µm in B’–E’'.

In primary polyps, putative PGC clusters initially form in the two primary mesenteries, which are distinguished by the presence of aborally-extended regions of pharyngeal ectoderm known as septal filaments (Figure 6A–A’, Video 1; Steinmetz et al., 2017). While the mechanism of primary mesentery specification is unknown, this process likely lies downstream of Hox-dependent endomesodermal segmentation in developing larvae. Interestingly, segmentation of the presumptive primary mesenteries is disrupted in both Anthox6a mutants and Gbx shRNA-KD polyps (He et al., 2018). In both of these conditions, we observed aberrant attachment of the septal filaments and the associated induction of PGC clusters in non-primary septa (Figure 6B–D’). This suggests that the precise location of the putative PGC clusters can be subject to regulation, and hints at the existence of zygotic PGC-inducing signals from the pharyngeal ectoderm.

PGC clusters are specified on mesenteries with primary septal filaments of wild-type, Anthox6a mutant and Gbx shRNA knockdown primary polyps.

Although primary mesenteries are missing in Anthox6a mutants or Gbx shRNA knockdown primary polyps, PGCs (labeled by Vas2 immunofluorescence in red) are specified on the mesenteries (arrowheads) where primary septal filaments attach (arrows). Scale bar = 50 µm in D’. All images are at the same scale.

PGC specification is dependent on zygotic Hedgehog signaling activity

Previous gene expression studies have suggested that the Hh signaling pathway may be involved in patterning the endomesoderm and potentially the formation of germ cells (Matus et al., 2008). Using double fluorescent in situ hybridization to detect the expression of Nematostella hedgehog1 (hh1) and its receptor patched (ptc) in late planula larvae, we found that both ligand and receptor were expressed in reciprocal domains of ectoderm and endomesoderm associated with the pharynx (Figure 7A). Later, the PGC clusters appeared within the endomesodermal ptc expression domain, adjacent to where hh1 is expressed in the pharyngeal ectoderm (Figure 7B–D’). Because PGCs formed in association with the juxtaposed hh1 and ptc expression domains, we hypothesized that Hh signaling may direct neighboring endomesodermal cells to assume PGC identity (Figure 7E).

Figure 7 with 1 supplement see all
Hh signaling is required for Nematostella PGC formation.

(A) Prior to PGC specification in planula larvae, hh1 (red) and ptc (green) are expressed in pharyngeal ectoderm and endomesoderm, respectively. (B–D’) In primary polyps, PGC clusters (white) are specified within the ptc expression domain, neighboring the hh1 domain. (D) Selected single focal plane of C. (D’) Enlarged view of boxed area in D, showing PGCs expressing ptc (green) and low hh1 signal (red). (E) Diagram depicting the relative expression domains of hh1 and ptc and PGC specification during metamorphosis. (F–I’) PGC formation on 8 dpf—indicated by Vas2 immunostaining and piwi1 fluorescent in situ hybridization—is impaired by hh1 or gli shRNA knockdown. (J) PGC numbers were significantly reduced following hh1 or gli knockdown. p values of ANOVA tests were compared with control GFP-shRNA injection. (K–M) gli gRNAa, gRNAb and Cas9 protein injected embryos showed reduced PGC numbers in six dpf primary polyps. p value of ANOVA test was compared with control GFP-gRNA injection. Scale bar = 50 µm in A, C, I and L; 10 µm in D’. B-D’ are at the same scale; F–I’ are at the same scale; K and L are at the same scale.

Figure 7—source data 1

PGC numbers in hh1- or gli-shRNA knockdown primary polyps.

https://cdn.elifesciences.org/articles/54573/elife-54573-fig7-data1-v1.csv
Figure 7—source data 2

PGC numbers in gli-gRNA injected primary polyps.

https://cdn.elifesciences.org/articles/54573/elife-54573-fig7-data2-v1.csv

To test functional requirements for Hh signaling in Nematostella development, we used shRNA-mediated knockdown and CRISPR/Cas9-directed mutagenesis (Ikmi et al., 2014; Kraus et al., 2016; He et al., 2018). Unfertilized eggs were injected with shRNAs targeting either hh1 or gli (a transcription factor downstream of Hh signaling) or with two independent gRNAs targeting gli. Using the expression of Vas2 protein and piwi1 transcripts as readouts for PGC identity, we found that PGC specification was significantly inhibited in both knockdown (Figure 7F–J) and presumptive F0 mutant primary polyps (Figure 7K–M; see Figure 7—figure supplement 1 and Materials and methods for gli gRNA target sites). These data suggest that the Hh signaling pathway is required for normal Nematostella PGC specification.

During Hh signal transduction, binding of Hh ligand to Ptc de-represses the transmembrane protein Smoothened (Smo), which in turn activates a cytoplasmic signaling cascade (Forbes, 1993; Alcedo et al., 1996; Stone et al., 1996; van den Heuvel and Ingham, 1996; Bangs and Anderson, 2017). To further test the involvement of Hh signaling in PGC formation, we treated developing animals with the Smo antagonists GDC-0449 (Vismodegib) or Cyclopamine (McCabe and Leahy, 2015; Sharpe et al., 2015). When early gastrulae were treated with either inhibitor, we did not observe significant developmental defects at our working concentration (Figure 8A–D). However, PGC numbers were significantly reduced (Figure 8E–H). To test Hh requirements for the establishment versus maintenance of PGC identity, we treated developing Nematostella with GDC-0449 either during PGC specification (4–8 dpf) or post-PGC specification (8–12 dpf; Figure 8—figure supplement 1A). Consistently, PGC formation was significantly inhibited by GDC-0449 treatment during 4 to 8 dpf metamorphosis (Figure 8—figure supplement 1B, compare Ctrl and GDC). In contrast, PGC number showed no significant difference when the pathway was inhibited after specification (Figure 8—figure supplement 1B, compare Ctrl-Ctrl and Ctrl-GDC). However, we observed significantly fewer PGCs in long-term control treatments (0.05% DMSO between 4–12 dpf, Ctrl-Ctrl) than in short-term controls (4–8 dpf, Ctrl). In wild-type primary polyps, there was no significant difference in mean PGC number between 8, 12 and 16 dpf primary polyps (Figure 1E). We therefore infer that the drug vehicle DMSO may have had deleterious effects on PGCs after specification. Furthermore, when we compared no-inhibition, continuous-inhibition and released-from-inhibition conditions (Figure 8—figure supplement 1B, compare Ctrl-Ctrl, GDC-GDC and GDC-Ctrl), PGC numbers did not vary significantly. These observations suggest that even though the initial PGC specification is Hh dependent, the PGC population can be dynamically replenished, potentially through cell proliferation. Additionally, we did not observe PGC migration defects in different combinations of GDC-0449 treatments. At 12 dpf we found that like control polyps, more than half of treated polyps still showed the expected PGC migration away from the clusters: 18 of 29 polyps in Ctrl-Ctrl; 18 of 30 polyps in Ctrl-GDC; 19 of 30 polyps in GDC-GDC; 16 of 30 polyps in GDC-Ctrl (p value of Chi-squared test comparing with Ctrl-Ctrl are 0.87, 0.92 and 0.5 respectively). Therefore, Hh signaling is not likely to be involved in PGC migration after the initial specification step.

Figure 8 with 1 supplement see all
Inhibiting Hh signaling by GDC-0449 or Cyclopamine impairs PGC formation.

(A–D) The majority of primary polyps did not show visible developmental defects after treatment with GDC-0449 or Cyclopamine from the gastrula stage onward. (E–H) Primary polyps treated with GDC-0449 or Cyclopamine from 1 to 8 dpf formed significantly fewer PGCs than controls. p values of ANOVA tests were compared with control treatment. Scale bar = 50 µm in G. A-C are at the same scale; E–G are at the same scale.

Figure 8—source data 1

Quantification of normal primary polyps and aberrant development after GDC-0449 or Cyclopamine treatment.

https://cdn.elifesciences.org/articles/54573/elife-54573-fig8-data1-v1.csv
Figure 8—source data 2

PGC numbers in GDC-0449 or Cyclopamine treated primary polyps.

https://cdn.elifesciences.org/articles/54573/elife-54573-fig8-data2-v1.csv

Hh signaling regulates endomesodermal patterning and PGC specification

To definitively test the requirements for Hh signaling in Nematostella, we next used an established CRISPR/Cas9 methodology to mutate hh1 (Ikmi et al., 2014; Kraus et al., 2016; He et al., 2018). These efforts generated three F1 heterozygous lines carrying frame-shift mutations (Figure 9, Figure 9—figure supplement 1, Figure 9—figure supplement 2; see Materials and methods). In F2 progeny resulting from crosses between heterozygous F1 siblings, we observed developmental defects in primary polyps wherein body length was reduced by approximately 50% and the four primary tentacles failed to elongate and partially fused together (Figure 9A–C’, Figure 9—figure supplement 2). Consistent with a defect in Hh signal transduction, homozygous mutants expressed lower levels of ptc, a conserved Hh pathway target gene (Figure 9D–E’). Primary polyps homozygous for either hh1 mutant allele developed primary mesentery-like endomesodermal septa; however, we did not observe Vas2, piwi1 or tudor expressing PGC-like cluster cells (Figure 9F–I’).

Figure 9 with 2 supplements see all
PGC clusters do not form in hh1 mutants.

(A–C’) hh1 homozygous mutant polyps exhibit a shorter body column and pronounced tentacle defects compared to wild-type siblings on 8 dpf. Additionally, no Vas2+ PGC clusters were detected in hh1 homozygous knockout polyps. (D–I’) FISH of ptc, piwi1 or tudor were followed by Vas2 immunohistochemistry on 12 dpf wild-type and hh11/hh11 mutants. (D–E’) hh1 mutant polyps show reduced ptc expression in the endomesoderm. (F–I’) hh1 mutant polyps lose PGC markers, including piwi1, tudor and Vas2. (A–C’) are multiple-focal planes projections. (D–I’) are from single-focal plane at the primary mesentery level. Scale bar = 50 µm in C’ and I’; A–C’ are at the same scale; D–I’ are at the same scale.

Morphological analysis revealed abnormal internal tissue patterning in hh1 homozygous mutants. In wild-type animals, the pharynx and primary septal filaments are separated from body wall ectoderm by intervening endomesodermal tissue (Figure 10A–A’). By contrast, in hh1 mutants part of the pharynx and the primary septal filaments were in direct contact with the ectoderm (Figure 10B–B’). As a result, the eight segments of the larval body plan were abnormally segregated into groups of three and five segments by the pharynx (Figure 10B). These defects were not observed in hh1 and gli shRNA knockdowns, suggesting that PGC formation may require a higher level of Hh signaling activity than endomesoderm patterning. The primary polyp-like hh1 homozygous mutants passed through gastrulation, indicating that the pharynx and the endomesoderm likely formed a continuous epithelium. Consistent with the hypothesis that a pharyngeal signal induces PGC development, hh1 mutants failed to develop PGCs even though the pharynx associated with the endomesoderm. Nevertheless, without more sophisticated genetic tools, we cannot rule out the possibility that PGC formation was indirectly perturbed by Hh-dependent endomesodermal patterning defects. In either case, we conclude that zygotic signaling activity is required for specification of the putative PGC clusters.

Figure 10 with 2 supplements see all
Patterning defects in hh1 and ptc mutants.

(A–B’) In addition to loss of putative PGCs, hh1 mutant polyps show endomesodermal patterning defects. Parts of the pharyngeal ectoderm and septal filaments (navy blue) abnormally contact the outer epidermis (azure blue), without endomesoderm tissue in between (yellow). These contacts segregated the normally contiguous eight endomesodermal segments into blocks of three and five segments along the directive axis. (C) Eighteen dpf F2 progeny from a cross between ptc3/+ heterozygous siblings. The abnormal mushroom-shaped polyps are indicated by red arrows. (D–D’) At the primary polyp stage (12 dpf), homozygous ptc mutants lack the four primary tentacles and do not develop the normal polyp body plan. (E–E’) A single focal plane taken at the level indicated by yellow arrows in D’. Depite significant morphological defects, ptc mutant animals develop a pharynx (navy blue), eight endomesodermal segments (yellow), body wall endomesoderm (orange) and putative PGC clusters (labeled by Vas2 immunofluorescence in red in D’). Scale bar = 20 µm in B’; 50 µm in D’ and E’. A-B’ are at the same scale; D–D’ are at the same scale; E–E’ are at the same scale.

PGC formation in ptc mutants may reflect a default Hh activation without the receptor

In bilaterian model systems, Ptc has been shown to serve as a receptor for the Hh ligand and to inhibit the pathway when the ligand is absent (Johnson et al., 2000). To further interrogate the mechanism of PGC specification in Nematostella, we generated four ptc heterozygous mutant lines (Figure 10C–D, Figure 10—figure supplement 1, Figure 10—figure supplement 2; see Materials and methods). Crosses between heterozygous siblings resulted in the expected 25% of homozygous progeny based on genotypic analysis, and these developed into abnormal mushroom-shaped polyps which lacked the four primary tentacles (Figure 10C–D, Figure 10—figure supplement 2). Detailed morphological examination and Vas2 immunofluorescence revealed that the ptc homozygous mutants developed a pharynx, eight endomesoderm mesenteries, and two PGC clusters (Figure 10D–E’). Combined with the requirement for hh1, gli and Smo activity during PGC specification, we propose that the presence of Hh ligand or absence of ptc activates the pathway and that zygotic Hh signaling provides permissive conditions for PGC formation within the pharyngeal domain of the Nematostella endomesoderm.

Discussion

In this report, we confirm that Nematostella putative PGCs form in pharyngeal endomesoderm and provide evidence that these cells delaminate via EMT and migrate through the mesoglea to populate the eight gonad primordia. We also demonstrate that putative PGCs form between the expression domains of hh1 and ptc and present evidence that Hh signaling is required for PGC specification but not PGC maintenance. Because Hh signaling transducers are only expressed zygotically (Matus et al., 2008; Lotan et al., 2014), these data indicate that Nematostella employs an inductive mechanism to specify PGC fate, which is consistent with the proposed ancestral mechanism for metazoan PGC specification (Extavour and Akam, 2003). Considering the existence of maternally-derived perinuclear Vas2 granules and vas1 and nos2 transcripts (Extavour et al., 2005; Praher et al., 2017), it remains possible that maternally inherited germline determinants still play some essential roles in PGC specification and that zygotic Hh activity serves to augment their function. In this combined maternal-zygotic scenario, the mechanism of Nematostella PGC formation would not neatly fit within either inheritance or induction, but instead falls within the continuum between either extreme, similar to sea urchin PGCs where maternal and zygotic factors cooperate in PGC determination (Nieuwkoop and Sutasurya, 1981; Voronina et al., 2008; Seervai and Wessel, 2013).

We labeled the origins of Nematostella putative PGC by the expression of Vas2 and other conserved germline marker genes. However, the observations do not exclude the possibility that Vas2+ cells can give rise to other somatic lineages because these conserved germline marker genes are also expressed and functional in multipotent stem cells of many species, such as Hydra, planaria and Platynereis dumerilii (Mochizuki et al., 2001; Reddien et al., 2005; Rebscher et al., 2007; Gustafson and Wessel, 2010; Wagner et al., 2012). In line with the theory of a ‘germline multipotency program’ where PGCs and multipotent stem cells are sister cell types and the specification and maintence of multipotency rely on these genes (Juliano et al., 2010), it is possible that the Vas2+ cells of Nematostella polyps contribute to both germline and soma. Alternatively, because our observations were made from static images, multiple rounds of PGC specification from other origins may exist. Other yet-identified pluripotent stem cells may also contribute to the Nematostella germline even after the initial PGCs have been specified. Based on our current data, we can simply propose that PGCs originate from the Vas2+ cell clusters in primary polyps. With more advanced genetic tools, we anticipate that the Nematostella PGC lineage will be revealed by live tracing methods.

Hh pathway activity in ptc mutants

In many bilaterian model organisms ptc is a transcriptional target of Hh signaling and serves as both a receptor and negative regulator of pathway activity (Briscoe and Thérond, 2013; Bangs and Anderson, 2017). We sought to functionally dissect Hh signaling in Nematostella and leveraged CRISPR/Cas9 mutagenesis to generate both hh1 and ptc mutants. While hh1 mutants lacked putative PGC cell clusters (Figure 9), to our surprise these cells formed properly in ptc mutant animals (Figure 10). This finding could be consistent with three possible scenarios: (1) The existence of residual receptor activity due to allele-specific effects or potential redundancy with an unannotated paralogue elsewhere in the genome; (2) An indirect or insufficient role for Hh in PGC specification; (3) A default repressive role for Ptc in the specification of pre-patterned PGC clusters. Because inhibiting Hh activity by disrupting either Smo or gli also disrupted PGC formation (Figure 7I–M; Figure 8), we suggest that Ptc most likely serves as a default inhibitor of Hh activity in Nematostella. Based on our combined data, we propose that the pharyngeal ectoderm releases Hh ligand to inhibit Ptc-dependent repression of PGC fate in the neighboring endomesoderm. This reasoning would suggest that the PGC clusters are pre-patterned by other yet-identified extracellular signals, and that the role of Hh activity may be to provide a spatial or temporal cue to trigger their maturation.

Direct versus indirect roles for Hh activity in PGC specification

To our knowledge, Hh signaling has not been directly implicated in PGC specification in previous studies of established bilaterian systems. Nevertheless, as summarized in Figure 11 and Table 1 and Table 2, a requirement for Hh signaling during Nematostella PGC formation is supported by three lines of evidence: (1) hh1 and gli shRNA knockdowns and gli CRISPR/Cas9 mutagenesis (Figure 7); (2) Smo inhibition assays (Figure 8); and (3) hh1 mutants (Figure 9). In developing primary mesenteries, PGCs are specified in endomesoderm cells that lie in close proximity to the hh1 expression domain in adjacent pharyngeal ectoderm (Figure 7A–E). Even in the absence of primary mesenteries in Anthox6a mutants and Gbx knockdown juveniles (Figure 6; He et al., 2018), PGCs still develop from endomesodermal cells in proximity to the pharyngeal ectoderm-derived septal filaments (Steinmetz et al., 2017). Interestingly, while hh1 expression seems to be restricted to the pharyngeal ectoderm and septal filaments, we observed broad endomesodermal patterning defects in hh1 mutants (Figure 10B–B’). This phenotype was not seen in either knockdown experiments or inhibitor assays where PGC specification was nevertheless inhibited (Figure 7 and Figure 8). This could suggest that the PGC defects in hh1 mutants are a direct result of aberrant endomesodermal patterning. Consistent with this, preliminary attempts to broadly overexpress Hh by injecting Ubiquitin>hh plasmid did not result in the induction of any apparent ectopic PGCs (data not shown). Still, looking forward, genetic tools that allow the discrimination between cell autonomous and cell non-autonomous mechanisms will be required to definitively rule out whether PGC formation is directly or indirectly regulated by Hh signaling.

A model of Nematostella PGC specification and migration.

(A) In wild-type 4 dpf tentacle bud larvae, hh1 (yellow) and ptc (orange) are expressed in the pharyngeal ectoderm and endomesoderm, respectively. Between 4 to 8 dpf when larvae metamorphose to primary polyps, Hh1 signals to neighboring endomesodermal cells and specifies Vas2/piwi1-positive PGC clusters (red) in the primary mesenteries. Meanwhile, perinuclear Vas2 granules (red dots) within endodermal cells (gray) gradually diminish. After initial specification, the PGC clusters undergo EMT and migrate to gonad rudiments during the juvenile stage. (B) hh1 KD, gli KD, hh1 mutants and gli gRNA-Cas9 injected embryos develop reduced or absent PGCs clusters, indicating a requirement for Hh signaling in this process, whether direct or indirect. (C) Drug treatments inhibiting Smo activity between 4 to 8 dpf impair PGC specification. However, some polyps still form reduced numbers of PGCs at later time points, possibly due to compensatory PGC proliferation. Note that the reduced ptc expression depicted in B is supported by FISH data in hh1 mutants but is presumptive in C.

Table 1
Primer sets for cloning probe templates into pPR-T4P (gene-specific regions are underlined).
TargetSequenceProbe size (bp)
piwi1ForwardCATTACCATCCCGCGAGCCTACAACCAGGAGAG1327
ReverseCCAATTCTACCCGCGTTGTGTTGATGCCCATAG
piwi2ForwardCATTACCATCCCGTGGGCGGTACTTCTACAACC1367
ReverseCCAATTCTACCCGTGCCCTTGATAAGGAGCATC
vas2ForwardCATTACCATCCCGTGAAGGGTCTCCAATTCCTG1530
ReverseCCAATTCTACCCGTGTGCAGATTACAGCCAAGG
tudorForwardCATTACCATCCCGGAACCTACTTGCTTCCGCAG1450
ReverseCCAATTCTACCCGACGACTCGGTGTTCCCATAG
twistForwardCATTACCATCCCGAAATCTCGGTGTCGGTCTTG1020
ReverseCCAATTCTACCCGTATCGCAGCTTTGCTTTCAG
hh1ForwardCATTACCATCCCGTTTCATTGGGAGCTAGTGGG1327
ReverseCCAATTCTACCCGAAAGCGTGAATTGGGTCTTG
ptcForwardCATTACCATCCCGGATGTGCGTGTGTGGGATAG1455
ReverseCCAATTCTACCCGACCGCGAGGTAATTGAACAC
Table 2
shRNA sequences.
TargetshRNA nameSequence
hh1hh1-shRNAaGGCTTGCTATAACACTGAT
hh1hh1-shRNAbGGCAGAGCTGTTGATATAA
gligli-shRNAGAGAAGAGGGATTTCACAT
GbxGbx-shRNAaGCCAAGGTTAATAGATCCT
GbxGbx-shRNAbGGAAACGTGTACGATCACT
eGFPeGFP-shRNAGACGTAAACGGCCACAAGTT

Future perspectives

In this report, we provide an initial framework demonstrating an inductive PGC formation mechanism in Nematostella vectensis, a representative early-branching animal. To our knowledge, there is no direct evidence about the involvement of Hh signaling in PGC specification in other organisms. One report from Hara and Katow showed hedgehog expression in the small micromeres (PGC precursors) of the sea urchin, Hemicentrotus pulcherrimus (Hara and Katow, 2005; Yajima and Wessel, 2011). Functional interrogation of Hh signaling did not address sea urchin PGC formation but suggests the pathway patterns mesoderm and regulates left-right asymmetry (Walton et al., 2009; Warner et al., 2016). Because complete hedgehog protein homologs appeared in the cnidarian-bilaterian common ancestor and the pathway is involved in many facets of development (Adamska et al., 2007; Ingham, 2001; King et al., 2008), it is possible that the pathway may serve to distinguish germline and soma in other eumetazoans as well. Alternatively, the requirement for Hh signaling in Nematostella PGC formation could be a lineage-specific feature, which could be tested through a broad sampling of PGC development in diverse anthozoan cnidarians.

Materials and methods

Key resources table
Reagent type
(species) or resource
DesignationSource or referenceIdentifiersAdditional information
Gene (Nematostella vectensis)vas1GenBankAY730696
Gene (Nematostella vectensis)vas2GenBankAY730697
Gene (Nematostella vectensis)piwi1GenBankMF683122
Gene (Nematostella vectensis)piwi2GenBankMF683123
Gene (Nematostella vectensis)tudorGenBankXM_032376221
Gene (Nematostella vectensis)twistGenBankAY286509
Gene (Nematostella vectensis)hh1GenBankEU162651
Gene (Nematostella vectensis)ptcGenBankEU162650
Gene (Nematostella vectensis)gliGenBankEU162649
Gene (Nematostella vectensis)Anthox6aGenBankGQ240845
Gene (Nematostella vectensis)gbxGenBankDQ500757
Genetic reagent (Nematostella vectensis)hh11This paperSee Figure 9—figure supplement 1
Genetic reagent (Nematostella vectensis)hh12This paperSee Figure 9—figure supplement 1
Genetic reagent (Nematostella vectensis)hh13This paperSee Figure 9—figure supplement 1
Genetic reagent (Nematostella vectensis)ptc1This paperSee Figure 10—figure supplement 1
Genetic reagent (Nematostella vectensis)ptc2This paperSee Figure 10—figure supplement 1
Genetic reagent (Nematostella vectensis)ptc3This paperSee Figure 10—figure supplement 1
Genetic reagent (Nematostella vectensis)ptc4This paperSee Figure 10—figure supplement 1
Peptide, recombinant proteinvas2This paperMCFKCQQTGHFARECPNESAAGENGDRPKPVTYVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPHHHHHH
Antibodyanti-vas2 (Rabbit polyclonal)This paperIF (1:1000), stock: 0.4 mg/mL
Antibodyanti-α-Tubulin (mouse monoclonal)Sigma-AldrichT9026IF (1:1000)
Antibodyanti-Phospho-Histone H3 (mouse monoclonal)Sigma-Aldrich05–806IF (1:1000)
Antibodyanti-DIG-POD Fab fragments (Sheep polyclonal)Sigma-Aldrich11207733910FISH (1:1000)
Antibodyanti-Fluorescein-POD Fab fragments (Sheep polyclonal)Sigma-Aldrich11426346910FISH (1:1000)
Chemical compound, drugGDC-0449Cayman Chemical1361325 µM
Chemical compound, drugCyclopamineCayman Chemical113215 µM
Chemical compound, drugBenzyl alcoholSigma-Aldrich305197
Chemical compound, drugBenzyl benzoateSigma-AldrichB6630
Commercial assay or kitClick-iT EdU KitThermo Fisher ScientificC10339
Commercial assay or kitTSA Plus Cyanine 3 SystemPerkinElmerNEL744001KT
Commercial assay or kitImProm-II Reverse Transcription SystemPromegaA3800
Commercial assay or kitT7 RNA polymerase KitPromegaP2077
Commercial assay or kitAmpliScribe T7-Flash Transcription KitLucigenASF3507
Software, algorithmImageJImageJ (http://imagej.nih.gov/ij/)RRID:SCR_003070
Software, algorithmImarisBitplaneRRID:SCR_0073708.3
Software, algorithmBoxPlotRBoxPlotR.shiny (https://github.com/VizWizard/BoxPlotR.shiny/blob/master/README.md)RRID:SCR_015629
OtherHoechst-34580 stainSigma-Aldrich634931 µg/mL
OtherSYBR Green I stainThermo Fisher ScientificS75671:5000
OtherPhalloidin stainThermo Fisher ScientificA123791:200
OtherDIG RNA labeling mixSigma-Aldrich11277073910
OtherFluorescein RNA labeling mixSigma-Aldrich11685619910
OtherCas9 protein with NLSPNA BioCP02500 ng/µL

Animal husbandry

Request a detailed protocol

Maintenance and spawning of N. vectensis followed previously established protocols (Stefanik et al., 2013). Embryos were cultured at 24°C incubator for consistent developmental staging.

Generation of anti-Vas2 antibody

Request a detailed protocol

A His-tagged antigen for raising polyclonal Rabbit-anti-Vas2 antibody was designed, synthesized and purified by GenScript (Piscataway, NJ). The antigen sequence (MCFKCQQTGHFARECPNESAAGENGDRPKPVTYVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPHHHHHH) partially encompasses the last zinc finger domain and the DEAD-like helicase domain of Vas2. In brief, the rabbit was immunized three times before checking the antibody titer, boosted once more and sacrificed for the whole serum. The serum was affinity purified, and the polyclonal antibody stock concentration is 0.4 mg/mL.

Whole-mount immunofluorescence

Request a detailed protocol

Our immunohistochemical staining protocol generally followed Genikhovich and Technau, 2009, with the following modifications: samples were blocked in 5% goat serum diluted in PBS with 0.2% Triton X-100 (PTx) and 10% DMSO for increasing antibody penetration. Samples were then incubated in 1:1000 diluted stock of Rabbit-anti-Vas2 antibody, Mouse-anti-α-Tubulin (Sigma-Aldrich; St. Louis, MO; Cat. No. T9026) or Mouse-anti-Phospho-Histone H3 (Sigma-Aldrich; Cat. No. 05–806) in PTx with 0.1% DMSO and 5% goat serum at 4°C overnight. After six washes with PTx for at least 20 min each at room temperature, samples were incubated with Alexa Fluor Goat-anti-Rabbit or Goat-anti-Mouse secondary antibodies (Thermo Fisher Scientific; Waltham, MA) at 1:500 dilution in PTx with 5% goat serum at 4°C overnight. If desired, during secondary antibody incubation, samples were counter-stained for F-Actin with Phalloidin at 1:200 dilution (Thermo Fisher Scientific) and nuclei with either 1 µg/mL of Hoechst-34580 (Sigma-Aldrich; Cat. No. 63493), 140 µM DAPI, or 1:5000 diluted SYBR Green I (Thermo Fisher Scientific; Cat. No. S7567). After several washes, samples were serially immersed in a final solution of 80% of glycerol in PTx. Alternatively, we dehydrated samples in isopropanol and immersed in BABB (one part of benzyl alcohol and two parts of benzyl benzoate) to clear the tissue, allowing up to 400 µm imaging depth (Wan et al., 2018).

EdU incorporation and Click-it reaction

Request a detailed protocol

To detect proliferating cells, juveniles were incubated in 800 µM EdU (Thermo Fisher Scientific) for 30 min and adults were incubated in 100 µM EdU for 12 hr together with artemia followed by fixation and dehydration with immunohistochemical staining protocol. The adult samples were then rehydrated and immersed in Tissue-Tek O.C.T. Compound (VWR) for cryosection at 10 µm intervals. After rehydration or washing out O.C.T. with PTx, whole-mount juveniles and tissue sections were incubated with Click-it reaction according to the manufacturer’s instructions.

Whole-mount fluorescent in situ hybridization (FISH)

Request a detailed protocol

To clone target genes, purified total RNA was reverse transcribed into cDNA by ImProm-II Reverse Transcription System (Promega; Madison, WI; Cat. No. A3800). Target gene fragments were first amplified from a mixed cDNA library of planula larva and primary polyps. Primers are listed in Table 3. We adopted a ligation-independent pPR-T4P cloning method (Newmark et al., 2003) to generate plasmids with probe templates and confirmed the positive clones by sequencing. We then PCR amplified the DNA template fragments using the AA18 (CCACCGGTTCCATGGCTAGC) and PR244 (GGCCCCAAGGGGTTATGTGG) primers, which flank the T7 promoter and the target gene sequence. After purifying DNA templates, we synthesized DIG-labeled RNA probes with the DIG RNA labeling mix (Sigma-Aldrich; Cat. No. 11277073910) and T7 RNA polymerase (Promega; Cat. No. P2077). Sample preparation, probe hybridization and signal detection followed established protocols (Steinmetz et al., 2017; He et al., 2018). The probe working concentration was 0.5 ng/µL for all genes.

For double FISH, we synthesized fluorescein-labeled RNA probes with the Fluorescein RNA labeling mix (Sigma-Aldrich; Cat. No. 11685619910) and hybridized together with a DIG-labeled probe of another gene. After detecting the first probe signal with TSA fluorescein reagent (PerkinElmer; Waltham, MA) and several washes with TNT buffer, we quenched peroxidase activity by incubating samples in 200 mM NaN3/TNT for 1 hr. Samples were then washed six times with TNT for at least 20 min each and then subjected to second-round probe detection by either anti-DIG-POD Fab fragments (Sigma-Aldrich; Cat. No. 11207733910) or anti-Fluorescein-POD Fab fragments (Sigma-Aldrich; Cat. No. 11426346910).

Table 3
gRNA sequence for CRISPR/Cas9 mutagenesis (PAM sequences are underlined).
TargetgRNA nameSequence
hh1hh1-gRNAaGGGAGCTAGTGGGAGACCACAGG
hh1hh1-gRNAbGCTCATGAGGCGATCGGCACCGG
ptcptc-gRNAaGGAGGGGTTTGGAGCATCACAGG
ptcptc-gRNAbAGAGGTGAAGGCCAGGACAGTGG
gligli-gRNAaGCGGCATGACCAGGAGGAGGTGG
gligli-gRNAbAGTGAGGTGGCTGTGGATGGTGG

Short hairpin RNA knockdown

Request a detailed protocol

shRNA design, synthesis and delivery followed the protocol of He et al., 2018 with the following modification: A reverse DNA primer containing the shRNA stem and linker sequence was annealed with a 20 nucleotide T7 promoter primer (TAATACGACTCACTATAGGG). The annealed, partially double stranded DNA directly served as template for in vitro transcription. We tested knockdown efficiency with shRNA produced by this modified method by targeting β-catenin and dpp shRNA, and found the same phenotypic penetrance as previously reported (He et al., 2018; Karabulut et al., 2019). To control for shRNA toxicity, we injected 1000 ng/µL eGFP shRNA and did not observe noticeable developmental defects. All shRNA working solutions were prepared at 1000 ng/µL and the sequences are listed in Table 4. By 8 dpf, primary polyps were fixed to assay PGC development.

Table 4
Summary of major observations during PGC development.
PGC eventDevelopmental stageData
Specification on primary mesenteries4–8 dpfFigure 1B–D
EMT and radial migrationjuveniles with feedingFigure 2C–E'Figure 3B–B'
Aboral migration to gonad rudimentsjuveniles with feedingFigure 3C–D', Figure 4

Generation of mutant lines by CRISPR/Cas9 mutagenesis

Request a detailed protocol

hh1 and ptc mutant lines were generated using established methods (Ikmi et al., 2014; Kraus et al., 2016; He et al., 2018). In brief, to generate F0 founders, we co-injected 500 ng/µl of gRNA (sequences listed in Table 5) and 500 ng/µl of SpCas9 protein into unfertilized eggs. Mosaic F0 founders were then crossed with wild-type sperm or eggs to create a heterozygous F1 population. When the F1 polyps reached juvenile stage, we genotyped individual polyps by cutting tentacle samples; the resultant alleles are described in Figure 9—figure supplement 1 and Figure 10—figure supplement 1. Heterozygous carriers of insertion/deletion-induced frame-shift alleles were crossed to generate homozygous mutants. The phenotypes and genotypes of the F2 population followed Mendelian inheritance and were subjected to further analysis. In progeny resulting from a hh11/+ cross, the observed phenotypic ratio of wild-type and mutant primary polyps was 948:343, close to the expected Mendelian ratio. Progeny from heterozygous crosses were also randomly genotyped and confirmed to follow the expected 1:2:1 ratio (+/+: hh11/+: hh11/hh11 = 6:14:8 and +/+: hh12/+: hh12/hh12 = 7:16:6). A similar strategy was used to analyze ptc mutants. ptc mutant genotypes also followed Mendelian segregation (+/+: ptc3/+: ptc3/ptc3 = 5:17:8). These results suggest the phenotypes observed in the hh1 and ptc mutant lines result from single locus mutations.

Table 5
Summary of experimental designs.
ExperimentTreatment durationData
Verify PGC specification in hh1 and gli shRNA knockdown0–8 dpfFigure 7F–J
Verify PGC specification in gli mutagenesis0–6 dpfFigure 7K–M
Verify PGC specification in Smo inhibition by GDC-0449 and Cyclopamine1–8 dpfFigure 8
Test Hh pathway on specification and post-specification by GDC-0449 temporal treatments4–8, 4–12 and 8–12 dpfFigure 8—figure supplement 1
Verify PGC specification in hh11 and hh12 mutants0–8 dpfFigure 9A–C'
Verify ptc and PGC marker expression in hh11 mutant0–12 dpfFigure 9D–I'
Verify PGC specification in hh13 mutant0–12 dpfFigure 9—figure supplement 2
Demonstrate patterning defects in hh11 mutant0–12 dpfFigure 10A–B'
Demonstrate the mutant morphology of ptc3 mutant0–18 dpfFigure 10C
Verify PGC specification and demonstrate the mutant morphology of ptc4 mutant0–12 dpfFigure 10D–E'
Demonstrate the mutant morphology of ptc1 and ptc2 mutants0–8 dpfFigure 10—figure supplement 2

We tried to generate gli mutant lines by co-injecting two gRNAs (500 ng/µl each; Table 1 and Figure 7—figure supplement 1) with 500 ng/µl of SpCas9 protein into unfertilized eggs. However, the F0 founders were >90% lethal at juvenile stage and the survivors were sterile. Therefore, we analyzed PGC formation in the F0 generation and as shown in Figure 7K–M.

Inhibitor treatments

Request a detailed protocol

GDC-0449 (Vismodegib, Cayman Chemical; Ann Arbor, MI; Cat. No. 13613) and Cyclopamine (Cayman Chemical; Cat. No. 11321) were diluted in DMSO as 50 mM and 10 mM stocks, respectively. These stocks were diluted 1:2000 in 12 ppt filtered artificial sea water (FSW) to generate working solution: 25 µM GDC-0449 and 5 µM Cyclopamine. 1:2000 diluted 100% DMSO (final 0.05%) was applied as a control. All treatments were protected from light and replaced with fresh working solutions every day.

Imaging and quantification

Request a detailed protocol

For confocal imaging, we used a Leica TCS Sp5 Confocal Laser Scanning Microscope or a Nikon 3PO Spinning Disk Confocal System. Bright field images were acquired using a Leica MZ 16 F stereoscope equipped with QICAM Fast 1394 camera (Qimaging; Surrey, BC, Canada). The brightness and contrast of images were adjusted by Fiji, and the PGC number of individual polyp was manually quantified by the Cell Counter Macro or automatically by blurring and masking the Vasa2 signal to find the cluster and 3D peak finding of the DAPI nuclei within the cluster (https://github.com/jouyun/pub-2020elifeChen, 2020; copy archived at https://github.com/elifesciences-publications/pub-2020elife). Serial z section images of N. vectensis pharyngeal structures were reconstructed as a 3D movie (Video 1) by Imaris 8.3 (Bitplane, Concord, MA). Box plots were generated by BoxPlotR (Spitzer et al., 2014). Statistic analysis was done by one-way analysis of variance (ANOVA). We recognize significant difference when the p-value is less than 0.05. Figures of this report were generated using Adobe Illustrator 2019.

Data availability

Original data underlying this manuscript can be accessed from the Stowers Original Data Repository at http://www.stowers.org/research/publications/libpb-1492.

The following data sets were generated
    1. Chen CY
    2. McKinney SA
    3. Ellington LR
    4. Gibson MC
    (2020) Stowers Original Data Repository
    ID libpb-1492. Hedgehog signaling is required for endomesodermal patterning and germ cell development in the sea anemone Nematostella vectensis.

References

    1. Forbes AJ
    (1993)
    Genetic analysis of hedgehog signalling in the Drosophila embryo
    Development Supplement 119:115–124.
  1. Book
    1. Nieuwkoop PD
    2. Sutasurya LA
    (1979)
    Primordial Germ Cells in the Chordates: Embryogenesis and phylogenesis
    Cambridge University Press.
  2. Book
    1. Nieuwkoop PD
    2. Sutasurya LA
    (1981)
    Primordial Germ Cells in the Invertebrates: From epigenesis to preformation
    Cambridge University Press.
    1. Yoon C
    2. Kawakami K
    3. Hopkins N
    (1997)
    ‘Zebrafish vasa homologue RNA is localized to the cleavage planes of 2- and 4-cell-stage embryos and is expressed in the primordial germ cells’
    Development 124:3157–3165.

Article and author information

Author details

  1. Cheng-Yi Chen

    Stowers Institute for Medical Research, Kansas City, United States
    Contribution
    Conceptualization, Data curation, Formal analysis, Visualization, Writing - original draft, Writing - review and editing
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-0520-346X
  2. Sean A McKinney

    Stowers Institute for Medical Research, Kansas City, United States
    Contribution
    Data curation, Formal analysis, Methodology, Writing - review and editing
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0002-9740-6247
  3. Lacey R Ellington

    Stowers Institute for Medical Research, Kansas City, United States
    Contribution
    Data curation, Methodology, Writing - review and editing
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0003-0872-5455
  4. Matthew C Gibson

    1. Stowers Institute for Medical Research, Kansas City, United States
    2. Department of Anatomy and Cell Biology, The University of Kansas School of Medicine, Kansas City, United States
    Contribution
    Conceptualization, Supervision, Funding acquisition, Writing - original draft, Writing - review and editing
    For correspondence
    mg2@stowers.org
    Competing interests
    No competing interests declared
    ORCID icon "This ORCID iD identifies the author of this article:" 0000-0001-5588-8842

Funding

Stowers Institute for Medical Research

  • Matthew C Gibson

The funders had no role in study design, data collection and interpretation, or the decision to submit the work for publication.

Acknowledgements

The authors would like to thank Gibson lab members for their suggestions and critical readings of the manuscript. Additionally, we thank the Stowers Institute Core Technology Centers, in particular Aquatics for Nematostella husbandry, Molecular Biology for sequencing and genotyping, and Histology for help with histological sectioning. We also appreciate insightful comments and suggestions from the reviewers and editors of eLife. This work was funded in its entirety by the Stowers Institute for Medical Research.

Copyright

© 2020, Chen et al.

This article is distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use and redistribution provided that the original author and source are credited.

Metrics

  • 2,529
    views
  • 267
    downloads
  • 24
    citations

Views, downloads and citations are aggregated across all versions of this paper published by eLife.

Citations by DOI

Download links

A two-part list of links to download the article, or parts of the article, in various formats.

Downloads (link to download the article as PDF)

Open citations (links to open the citations from this article in various online reference manager services)

Cite this article (links to download the citations from this article in formats compatible with various reference manager tools)

  1. Cheng-Yi Chen
  2. Sean A McKinney
  3. Lacey R Ellington
  4. Matthew C Gibson
(2020)
Hedgehog signaling is required for endomesodermal patterning and germ cell development in the sea anemone Nematostella vectensis
eLife 9:e54573.
https://doi.org/10.7554/eLife.54573

Share this article

https://doi.org/10.7554/eLife.54573